Align mannitol dehydrogenase (EC 1.1.1.255) (characterized)
to candidate 3607519 Dshi_0931 Alcohol dehydrogenase GroES domain protein (RefSeq)
Query= BRENDA::Q38707 (365 letters) >FitnessBrowser__Dino:3607519 Length = 339 Score = 168 bits (425), Expect = 2e-46 Identities = 100/316 (31%), Positives = 160/316 (50%), Gaps = 11/316 (3%) Query: 39 DVRLKVLFCGVCHSDHHMIHNNWGFTTYP-IVPGHEIVGVVTEVGSKVEKVKVGDNVGIG 97 ++ +K+ CGVCH+D H +W P +PGHE VGVV EVG V VK GD VG+ Sbjct: 30 NILVKIEACGVCHTDLHAARGDWPVKPEPPFIPGHEGVGVVVEVGHNVTSVKEGDRVGVP 89 Query: 98 CLVGSCRSCESCCDNRESHCENTIDTYGSIYFDGTMTHGGYSDTMVADEHFILRWPKNLP 157 L +C C +C E+ C + + G +GG+++ + AD ++ P L Sbjct: 90 WLHHACGHCTACVTGWETLCRTEPE------YTGYTVNGGFAEYVEADPTYVGHLPDKLD 143 Query: 158 LDSGAPLLCAGITTYSPLKYYGLDKPGTKIGVVGLGGLGHVAVKMAKAFGAQVTVIDISE 217 AP+LCAG+T Y LK L PG + + G+GGLGH+AV+ A+A G V +D++E Sbjct: 144 FAPAAPILCAGVTVYKGLKECDL-HPGQTVVISGIGGLGHLAVQYARAMGLHVIAVDVAE 202 Query: 218 SKRKEALEKLGADSFLLNSDQEQMK--GARSSLDGIIDTVPVNHPLAPLFDLLKPNGKLV 275 K A + LGA + + Q+ + +G++ T N + +L P G + Sbjct: 203 DKLALARD-LGAGVAINAATQDPVAEVARLGGAEGVLVTAVSNTAFSQGVGMLAPGGTMS 261 Query: 276 MVGAPEKPFELPVFSLLKGRKLLGGTINGGIKETQEMLDFAAKHNITADVEVIPMDYVNT 335 +VG P F L +F ++ RK + G+I G + E L FAA+ + + +D +N Sbjct: 262 LVGLPPGDFPLNIFDVVLNRKTIRGSIVGTRADLAESLSFAAEGKVASHYATDSLDNING 321 Query: 336 AMERLVKSDVRYRFVI 351 +++ + + R V+ Sbjct: 322 IFDQMEQGRIEGRIVM 337 Lambda K H 0.319 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 339 Length adjustment: 29 Effective length of query: 336 Effective length of database: 310 Effective search space: 104160 Effective search space used: 104160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory