Align mannitol 2-dehydrogenase (EC 1.1.1.67) (characterized)
to candidate 3607519 Dshi_0931 Alcohol dehydrogenase GroES domain protein (RefSeq)
Query= BRENDA::Q6ECH5 (336 letters) >FitnessBrowser__Dino:3607519 Length = 339 Score = 118 bits (295), Expect = 2e-31 Identities = 97/309 (31%), Positives = 137/309 (44%), Gaps = 21/309 (6%) Query: 3 ALVLTGKKQLEIEDIKEPEIKPDEVLIHTAYAGICGTDKALYAGLPGSASAVPPIVLGHE 62 ALV K LEI ++++P + +L+ G+C TD G PP + GHE Sbjct: 7 ALVTDFSKPLEIREVRKPTVTDGNILVKIEACGVCHTDLHAARG-DWPVKPEPPFIPGHE 65 Query: 63 NSGVVTKVGSEVTNVKPGDRVTVDPNIY--CGQCKYCRTQRPELCE-HLDAVGVTRNGGF 119 GVV +VG VT+VK GDRV V P ++ CG C C T LC + G T NGGF Sbjct: 66 GVGVVVEVGHNVTSVKEGDRVGV-PWLHHACGHCTACVTGWETLCRTEPEYTGYTVNGGF 124 Query: 120 EEYFTAPAKVVYPIPDDVSLKAAAVVEPISCA----MHGVDLLETHPYQKALVLGDGFEG 175 EY A V +PD + AA PI CA G+ + HP Q ++ G G G Sbjct: 125 AEYVEADPTYVGHLPDKLDFAPAA---PILCAGVTVYKGLKECDLHPGQTVVISGIGGLG 181 Query: 176 QLFAQILKARGIHEVTLAGRSDEKLENNRKHFGVKTIDTTKEEIP-----ADAYDIVVEA 230 L Q +A G+H + + D+ GV T++ + A ++V A Sbjct: 182 HLAVQYARAMGLHVIAVDVAEDKLALARDLGAGVAINAATQDPVAEVARLGGAEGVLVTA 241 Query: 231 VGLPATQEQALAAAARGAQVLMFGVGNPDDKFSVNTYDVFQKQLTIQGAFVNPYT-FEDS 289 V A + A G L VG P F +N +DV + TI+G+ V +S Sbjct: 242 VSNTAFSQGVGMLAPGGTMSL---VGLPPGDFPLNIFDVVLNRKTIRGSIVGTRADLAES 298 Query: 290 IALLSSGVV 298 ++ + G V Sbjct: 299 LSFAAEGKV 307 Lambda K H 0.316 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 339 Length adjustment: 28 Effective length of query: 308 Effective length of database: 311 Effective search space: 95788 Effective search space used: 95788 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory