Align SmoF, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate 3607946 Dshi_1354 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= TCDB::O30832 (290 letters) >FitnessBrowser__Dino:3607946 Length = 416 Score = 105 bits (261), Expect = 2e-27 Identities = 69/237 (29%), Positives = 120/237 (50%), Gaps = 7/237 (2%) Query: 54 DNYYYFLTDPAFSAALTNTILLVVGVLLITVVGGVLLALLLDQPFWGQGIVRVLVIAPFF 113 +N+ F L T+ V L ++ G+ ALLL++ F GQGI+R L + P+ Sbjct: 179 ENFARIFDADEFWGVLGVTMFYTVFGTLGALLFGLFAALLLNKSFRGQGILRGLYLFPYV 238 Query: 114 VMPTVSALVWKNMFMNPVNGMFAHIARGLGLP--PFDFLSQAPLASIIGIV--AWQWLPF 169 A W +F +P +G + +G+ +F Q PLA I+ V W++ P Sbjct: 239 APVIAVAFTWVTLF-DPFSGSANALLIQMGVTNEAINFFGQRPLALIMVTVFEIWRYFPL 297 Query: 170 ATLILLTALQSLDREQMEAAEMDGASALDRFIHITVPHLTRAITVVVLIQTIFLLGVFAE 229 + L +L +QS+D + EAA+MDGAS +F ++++P L ++V+ L++ I+ F + Sbjct: 298 SFLFILARMQSIDTDMYEAADMDGASPFQKFWYLSLPMLVGILSVLFLLRFIWTFNKFDD 357 Query: 230 ILVTTNGGPGTASTNITYLVYAQSLLNYDVGGGSAGGIVAVVLANIVAIFLMRMIGK 286 I + T G GT + +T VY Q+ ++G G+A +V + ++ R I + Sbjct: 358 IFLLTGGNAGTRT--LTVNVYEQAFAVSNIGAGAAVAVVIFGCLLLFSVLFFRFISR 412 Lambda K H 0.329 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 259 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 416 Length adjustment: 29 Effective length of query: 261 Effective length of database: 387 Effective search space: 101007 Effective search space used: 101007 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory