Align Inositol transport system sugar-binding protein (characterized)
to candidate 3607866 Dshi_1274 periplasmic binding protein/LacI transcriptional regulator (RefSeq)
Query= reanno::Phaeo:GFF715 (316 letters) >FitnessBrowser__Dino:3607866 Length = 325 Score = 480 bits (1236), Expect = e-140 Identities = 232/317 (73%), Positives = 269/317 (84%), Gaps = 3/317 (0%) Query: 1 MTSIFKTFMLATTVAAAPMMLATTASAEGE-KYILVSHAPDSDSWWNTIKNGIALAGEQM 59 M +I K+ L + AAP A+ A ++ + Y+LVSHAPDSD+WWNTIKNGIALAGEQM Sbjct: 11 MKTILKSVALGAALVAAPF--ASFAQSDDDLNYVLVSHAPDSDTWWNTIKNGIALAGEQM 68 Query: 60 NVEVEYRNPPTGDLADMARIIEQAAASGPNGIITTLSDYDVLSGPIKAAVDSGVDVIIMN 119 V VEYRNPPTGD+ADMARIIEQAAAS P+GIITTL+D+DVL GPIK AVD G+DVIIMN Sbjct: 69 GVSVEYRNPPTGDIADMARIIEQAAASAPDGIITTLADFDVLQGPIKNAVDQGIDVIIMN 128 Query: 120 SGTPDQAREVGALMYVGQPEYDAGHAAGMRAKADGVGSFLCVNHYISSPSSTERCQGFAD 179 +GTP+QARE+GALMYVGQPEYDAG AAG RAK +GV FLCVNH I P+ ERC+G+AD Sbjct: 129 TGTPEQAREIGALMYVGQPEYDAGFAAGQRAKGEGVTKFLCVNHAIQQPTVGERCRGYAD 188 Query: 180 GLGVDLGDQMIDSGQDPAEIKNRVLAYLNTNPETDAILTLGPTSADPTLLALDENGMAGD 239 GLG++LGD M+DSG DPAEIKN+V+AYL+TN + D ILTLGP SADPT+ AL+E G+AG+ Sbjct: 189 GLGIELGDAMMDSGTDPAEIKNKVMAYLSTNEDVDGILTLGPVSADPTIAALNEMGLAGE 248 Query: 240 IYFGTFDLGEEIVKGLKSGVINWGIDQQPFLQAYLPVVVLTNYHRYGVLPGNNINSGPGF 299 I+FGTFDLGEEIVK +K G INWGIDQQPFLQAY+PVV+L N+ RYGVLPGNNINSGPGF Sbjct: 249 IHFGTFDLGEEIVKAIKDGTINWGIDQQPFLQAYMPVVILANWDRYGVLPGNNINSGPGF 308 Query: 300 VTKDGLEKVEEFAGEYR 316 VT GLEKVE FAGEYR Sbjct: 309 VTASGLEKVEAFAGEYR 325 Lambda K H 0.315 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 474 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 325 Length adjustment: 28 Effective length of query: 288 Effective length of database: 297 Effective search space: 85536 Effective search space used: 85536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory