Align Inositol transport system ATP-binding protein (characterized)
to candidate 3608605 Dshi_1998 ABC transporter related (RefSeq)
Query= reanno::Phaeo:GFF717 (261 letters) >FitnessBrowser__Dino:3608605 Length = 248 Score = 174 bits (442), Expect = 1e-48 Identities = 93/243 (38%), Positives = 144/243 (59%), Gaps = 3/243 (1%) Query: 6 PLIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDIL 65 PL+ + I FG + A+ GVS+D++PGE LLG NGAGKST IK ++G ++ G+I Sbjct: 3 PLVELDDISISFGGIRAVDGVSLDLYPGEVVGLLGHNGAGKSTLIKILAGAYRKDSGEIR 62 Query: 66 FEGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYAN 125 G+ PRDA I T++Q LA+ + S N F+G E ++G D Sbjct: 63 INGKKAEINSPRDARRYNIETIYQTLALADNLDASSNLFLGRELTTRLG---FVDDTRME 119 Query: 126 RITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTA 185 T M ++ N + + V LSGG+RQ+VAIARAV+F A++LI+DEPT+ALGV +T Sbjct: 120 AETRRIMARLNPNFQKLSEPVSALSGGQRQSVAIARAVYFNAQILIMDEPTAALGVHETQ 179 Query: 186 NVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEELQDMMA 245 V I +++ QG+ + I+H+ R L + DR +V+ GK +GT + D++ +++ M+ Sbjct: 180 MVADLIKELKAQGLGIFLISHDTREMLELCDRVSVMKNGKLVGTERVEDVTEDDILSMII 239 Query: 246 GGQ 248 G+ Sbjct: 240 LGK 242 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 248 Length adjustment: 24 Effective length of query: 237 Effective length of database: 224 Effective search space: 53088 Effective search space used: 53088 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory