Align Inositol ABC transport system, permease protein IatP, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized)
to candidate 3607096 Dshi_0518 Monosaccharide-transporting ATPase (RefSeq)
Query= TCDB::B8H230 (332 letters) >FitnessBrowser__Dino:3607096 Length = 336 Score = 164 bits (415), Expect = 3e-45 Identities = 106/332 (31%), Positives = 172/332 (51%), Gaps = 22/332 (6%) Query: 19 LLAFARKHRTILFLLLLVAVFGAANERFLTARNALNILSEVSIYGIIAVGMTFVILIGGI 78 LL A ++ ++ L L+ F A FL +A +L V+I GI+A+G+T +++GG Sbjct: 5 LLDIAIRYGFLMLLFGLIVYFSLAAPGFLGPLSAAFVLQSVAITGILALGVTCTLVVGGF 64 Query: 79 DVAVGSLLAFASIAAAYVVTAVVGDGPATWLIALLVSTLIGLAGGYVQGKAVTWLHVPAF 138 D+++G++ A + +AY + V+ + PA ++A+L+ +G G++ G + VP Sbjct: 65 DLSIGAVATSALMLSAY--SMVILEHPA--IVAVLLCLAMGALVGFINGLLIVKFRVPDL 120 Query: 139 IVTLGGMTVWRGAT------------LLLNDGGPISG-FNDAYRWWGSGEI-----LFLP 180 + TLG M + G + L+DG G F+ A+ W G LP Sbjct: 121 LATLGMMFLLIGLQRIPTQGNSIATGMTLSDGTVAEGTFSAAFLWLGRHRFDVVIERLLP 180 Query: 181 VPVVIFALVAAAGHVALRYTRYGRQVYAVGGNAEAARLSGVNVDFITTSVYAIIGALAGL 240 +PVVIF +A + L +TR+GR +YA+G N AA L G V+ + Y I G A + Sbjct: 181 MPVVIFVGIAVLIWLFLGFTRHGRLMYAIGSNERAAGLVGTPVNRYKIAAYMISGVTASI 240 Query: 241 SGFLLSARLGSAEAVAGTGYELRVIASVVIGGASLTGGSGGVGGTVLGALLIGVLSNGLV 300 G LL+ARLG + +G L +A+ +IG A L GT +GAL +G+L G+ Sbjct: 241 GGILLAARLGRGDIASGNNLLLDSVAAALIGFAVLGAARPNAFGTAMGALFVGILLQGMT 300 Query: 301 MLHVTSYVQQVVIGLIIVAAVAFDHYARTHKA 332 M++ Y Q V G ++VAA+ F Y + ++ Sbjct: 301 MMNAPYYTQDFVKGAVLVAALVFTFYLSSRRS 332 Lambda K H 0.325 0.140 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 336 Length adjustment: 28 Effective length of query: 304 Effective length of database: 308 Effective search space: 93632 Effective search space used: 93632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory