Align 5-dehydro-2-deoxygluconokinase (EC 2.7.1.92) (characterized)
to candidate 3607860 Dshi_1268 PfkB domain protein (RefSeq)
Query= reanno::Phaeo:GFF709 (330 letters) >FitnessBrowser__Dino:3607860 Length = 333 Score = 514 bits (1324), Expect = e-150 Identities = 255/316 (80%), Positives = 282/316 (89%) Query: 11 LAGRNFLVIGRVGMDLCPTPAGTATADAQDMMVAMGGSSANIAAGLVKMGCRSALVTSVS 70 + RNFLVIGRVGMDL P PAGTA DA D+MVAMGGSSANIAAGLVK G R+ALVT VS Sbjct: 8 IRSRNFLVIGRVGMDLSPAPAGTAIEDATDLMVAMGGSSANIAAGLVKFGARAALVTRVS 67 Query: 71 DDAVGWYCLNQLDHYGVDRTHVKRITGEYRTSLAVYESRVEDHQSVIYRNNAADFQMTIA 130 DDAVG YCLNQL YGVD THV + GE+R SLA+YESR+ DH SVIYRN AADFQM++A Sbjct: 68 DDAVGRYCLNQLAAYGVDATHVTPVAGEFRNSLALYESRLADHNSVIYRNGAADFQMSVA 127 Query: 131 DVEAVDYSQYSALITAGTVFAAEPSRSATFRAFDLARAAGLPIIFDVDYRPYSWPSPEVA 190 DVEAVDYSQY ALITAGTVFAAEPSRSATFRAF+LARAAGLPIIFDVDYRPYSWPSP+VA Sbjct: 128 DVEAVDYSQYGALITAGTVFAAEPSRSATFRAFELARAAGLPIIFDVDYRPYSWPSPQVA 187 Query: 191 ADVLSRAGAMSDIIVGNDEEFGFMAGGIDKGRAKARALAETSASVVVYKMGPKGAVTFAD 250 +VLSRAGA+SDIIV NDEEFGFMAGGIDKG AKAR LA+TSA +VVYKMGP+GA+TFA+ Sbjct: 188 EEVLSRAGALSDIIVANDEEFGFMAGGIDKGLAKARELAQTSAGIVVYKMGPEGAITFAN 247 Query: 251 GQEIRTGIYPVDALKPTGAGDSFMAGFLASLSEGRPMKDAILRGSACASVVVAKPGCAPA 310 G E+RTGIYPV ALKPTGAGDSFMAGFLASL+EGR +++A+LRGSACA++VVAKPGCAPA Sbjct: 248 GTELRTGIYPVTALKPTGAGDSFMAGFLASLAEGRELREAVLRGSACAAIVVAKPGCAPA 307 Query: 311 MPDLAALEAFLATHPG 326 MPD L+AFLA HPG Sbjct: 308 MPDARELDAFLARHPG 323 Lambda K H 0.319 0.132 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 333 Length adjustment: 28 Effective length of query: 302 Effective length of database: 305 Effective search space: 92110 Effective search space used: 92110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate 3607860 Dshi_1268 (PfkB domain protein (RefSeq))
to HMM TIGR04382 (iolC: 5-dehydro-2-deoxygluconokinase (EC 2.7.1.92))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR04382.hmm # target sequence database: /tmp/gapView.7299.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR04382 [M=309] Accession: TIGR04382 Description: myo_inos_iolC_N: 5-dehydro-2-deoxygluconokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-105 337.3 0.2 5.1e-105 337.1 0.2 1.0 1 lcl|FitnessBrowser__Dino:3607860 Dshi_1268 PfkB domain protein (R Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3607860 Dshi_1268 PfkB domain protein (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 337.1 0.2 5.1e-105 5.1e-105 3 309 .] 12 318 .. 10 318 .. 0.98 Alignments for each domain: == domain 1 score: 337.1 bits; conditional E-value: 5.1e-105 TIGR04382 3 dlitiGRvgvDlyaqqigasledvksfakylGGspaNiavgaarlGlktalitkvgddqlGrfvreeleregvdtsh 79 ++++iGRvg+Dl ++ +g+++ed+++ + +GGs+aNia+g+ ++G+++al+t+v+dd++Gr+++++l++ gvd++h lcl|FitnessBrowser__Dino:3607860 12 NFLVIGRVGMDLSPAPAGTAIEDATDLMVAMGGSSANIAAGLVKFGARAALVTRVSDDAVGRYCLNQLAAYGVDATH 88 789************************************************************************** PP TIGR04382 80 vvtdk.eartslvlleikdpdefpllfYRenaaDlaltvddvdeeliaeakallvsgtalskepsreavlkalelak 155 v+ + e+r+sl+l+e + +d ++ ++YR+ aaD++++v+dv++ ++++ al+++gt +++epsr+a+++a+ela+ lcl|FitnessBrowser__Dino:3607860 89 VTPVAgEFRNSLALYESRLAD-HNSVIYRNGAADFQMSVADVEAVDYSQYGALITAGTVFAAEPSRSATFRAFELAR 164 *****99************99.999**************************************************** PP TIGR04382 156 kagvkvvlDiDYRpvlWkskeeasaalqlvlkkvdviiGteeEfeiaag.ekddeaaakallelgaelvvvKrGeeG 231 +ag +++D+DYRp++W s++ a+++l+++ +++d+i++++eEf ++ag ++ a+a++l++++a +vv+K+G+eG lcl|FitnessBrowser__Dino:3607860 165 AAGLPIIFDVDYRPYSWPSPQVAEEVLSRAGALSDIIVANDEEFGFMAGgIDKGLAKARELAQTSAGIVVYKMGPEG 241 ***********************************************88689999********************** PP TIGR04382 232 slvytkdeeevevkgfkvevlkvlGaGDaFasgllygllegedlekalelanAagaivvsrlscaeamptleeleef 308 ++++++ +e+++++++v++lk GaGD+F++g+l +l eg++l++a+ ++A++aivv++ +ca+amp+++el++f lcl|FitnessBrowser__Dino:3607860 242 AITFANG-TELRTGIYPVTALKPTGAGDSFMAGFLASLAEGRELREAVLRGSACAAIVVAKPGCAPAMPDARELDAF 317 *****99.*******************************************************************99 PP TIGR04382 309 l 309 l lcl|FitnessBrowser__Dino:3607860 318 L 318 7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (333 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.51 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory