Align inositol 2-dehydrogenase (EC 1.1.1.18) (characterized)
to candidate 3607857 Dshi_1265 Inositol 2-dehydrogenase (RefSeq)
Query= BRENDA::O68965 (330 letters) >FitnessBrowser__Dino:3607857 Length = 327 Score = 336 bits (861), Expect = 5e-97 Identities = 173/315 (54%), Positives = 215/315 (68%) Query: 3 VRFGLLGAGRIGKVHAKAVSGNADARLVAVADAFPAAAEAIAGAYGCEVRTIDAIEAAAD 62 ++ GLLG GRIG+VHA+++S A+ARLVAVADA P AA+A+A G EVR + I A D Sbjct: 1 MKLGLLGCGRIGQVHARSLSRIAEARLVAVADAVPEAAQALAARAGAEVRGSEEIITAPD 60 Query: 63 IDAVVICTPTDTHADLIERFARAGKAIFCEKPIDLDAERVRACLKVVSDTKAKLMVGFNR 122 IDAV++ TPT H + I A AGKAIFCEKPIDL AER C + V + FNR Sbjct: 61 IDAVIVATPTTLHFEQIHAIAAAGKAIFCEKPIDLSAERAAQCQQAVEAAGVPFLTAFNR 120 Query: 123 RFDPHFMAVRKAIDDGRIGEVEMVTITSRDPSAPPVDYIKRSGGIFRDMTIHDFDMARFL 182 RFDP F + + DG IGE+EMV ITSRDP+ PP+ YI+ SGG+FRDM IHDFDMARFL Sbjct: 121 RFDPSFAHLHDQVRDGAIGEIEMVVITSRDPAPPPISYIESSGGLFRDMMIHDFDMARFL 180 Query: 183 LGEEPVSVTATAAVLIDKAIGDAGDYDSVSVILQTASGKQAIISNSRRATYGYDQRIEVH 242 LGEEP + A + L+D AIG AGD D+ V L+TASG+ I+NSRRATYGYDQRIEVH Sbjct: 181 LGEEPAEIHAFGSCLVDPAIGAAGDIDTAMVTLRTASGRLCQINNSRRATYGYDQRIEVH 240 Query: 243 GSKGAVAAENQRPVSIEIATGDGYTRPPLHDFFMTRYTEAYANEIESFIAAIEKGAEIAP 302 GSKG + A NQ + A+G G+T DFF+ RY AY E+ F+ A+ +G+ + Sbjct: 241 GSKGMLQAANQPAHLVTQASGGGFTAARSMDFFLERYEAAYLAEMTHFVDAVTRGSPLKA 300 Query: 303 SGNDGLAALALADAA 317 + DG+AA LAD A Sbjct: 301 TIADGVAAQRLADTA 315 Lambda K H 0.320 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 327 Length adjustment: 28 Effective length of query: 302 Effective length of database: 299 Effective search space: 90298 Effective search space used: 90298 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate 3607857 Dshi_1265 (Inositol 2-dehydrogenase (RefSeq))
to HMM TIGR04380 (iolG: inositol 2-dehydrogenase (EC 1.1.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR04380.hmm # target sequence database: /tmp/gapView.1788910.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR04380 [M=330] Accession: TIGR04380 Description: myo_inos_iolG: inositol 2-dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-130 418.6 0.5 8e-130 418.5 0.5 1.0 1 lcl|FitnessBrowser__Dino:3607857 Dshi_1265 Inositol 2-dehydrogena Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3607857 Dshi_1265 Inositol 2-dehydrogenase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 418.5 0.5 8e-130 8e-130 2 328 .. 1 324 [. 1 326 [. 0.99 Alignments for each domain: == domain 1 score: 418.5 bits; conditional E-value: 8e-130 TIGR04380 2 lkigiiGaGRigkvHaenlakkvpeaelaavvdvaeeaakelaeklgieevvedveailedpevdAvliasptdtHa 78 +k+g++G GRig+vHa++l++ ea+l+av+d++ eaa++la++ g+ v+ e+i++ p++dAv++a+pt++H lcl|FitnessBrowser__Dino:3607857 1 MKLGLLGCGRIGQVHARSLSRI-AEARLVAVADAVPEAAQALAARAGA--EVRGSEEIITAPDIDAVIVATPTTLHF 74 589****************986.*************************..88899********************** PP TIGR04380 79 eliveaakagkhifcEKPidldleeikealkavekagvklqiGfnRRFDanfaevkklveagkiGklellritsrDP 155 e+i + a+agk+ifcEKPidl+ e++ ++++ave+agv+++ fnRRFD++fa+++++v++g iG++e++ itsrDP lcl|FitnessBrowser__Dino:3607857 75 EQIHAIAAAGKAIFCEKPIDLSAERAAQCQQAVEAAGVPFLTAFNRRFDPSFAHLHDQVRDGAIGEIEMVVITSRDP 151 ***************************************************************************** PP TIGR04380 156 apppveyvkvsGglflDmtiHDfDmarfllgseveevyaagsvlvdpeleeagdvdtavvvlkfengalaviensrr 232 appp++y+++sGglf+Dm+iHDfDmarfllg+e+ e++a gs+lvdp+++ agd+dta+v+l++++g+l+ i+nsrr lcl|FitnessBrowser__Dino:3607857 152 APPPISYIESSGGLFRDMMIHDFDMARFLLGEEPAEIHAFGSCLVDPAIGAAGDIDTAMVTLRTASGRLCQINNSRR 228 ***************************************************************************** PP TIGR04380 233 aayGYdqrvEvfGskGslraendtestvvlsdeegvraekpenfFleRyaeayraeikafvdailedkevsvtaeDg 309 a+yGYdqr+Ev+GskG+l+a+n+ ++ v+ ++ g++a+++ fFleRy++ay ae+++fvda++++++ + t+ Dg lcl|FitnessBrowser__Dino:3607857 229 ATYGYDQRIEVHGSKGMLQAANQPAHLVTQASGGGFTAARSMDFFLERYEAAYLAEMTHFVDAVTRGSPLKATIADG 305 ***************************************************************************** PP TIGR04380 310 lkalklalaakrsleegra 328 ++a++la+ a+ + ++g++ lcl|FitnessBrowser__Dino:3607857 306 VAAQRLADTADTARKTGKV 324 *************999986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (327 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 23.76 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory