Align Inositol 2-dehydrogenase; EC 1.1.1.18; Myo-inositol 2-dehydrogenase; MI 2-dehydrogenase (uncharacterized)
to candidate 3607862 Dshi_1270 oxidoreductase domain protein (RefSeq)
Query= curated2:Q1AV95 (347 letters) >FitnessBrowser__Dino:3607862 Length = 372 Score = 68.2 bits (165), Expect = 3e-16 Identities = 84/273 (30%), Positives = 113/273 (41%), Gaps = 38/273 (13%) Query: 8 IAVGVVGTGGMGGMHAENLHFRVPG---ARLVAVADLDTRRAGGVAERSGA-----EVFE 59 I VG+VG G MG HA H V RL ++ + AER A Sbjct: 4 IGVGIVGGGYMGKAHAV-AHASVGALFNTRLRPRLEMVAASSRASAERYRAAFGFRRAAP 62 Query: 60 DGFDLIRSDRVEAVVIASPDPTHAPLVLECLKNEKPVLCEKPLADSADAARKVVEAEVEL 119 D L+ VEAVVIASP TH +V KPV CEKPL S + A + EA Sbjct: 63 DWETLVADPHVEAVVIASPQDTHRAIVEAAAALGKPVFCEKPLGASLEDAIAITEAAERA 122 Query: 120 GRKLVQVGFMRRYDPQHVAVKEAVASGAVGAPVLFRGWH-RNADIEPGITSEW---VVIN 175 G + VGF P + +A G +G FRG H + +P + + W + N Sbjct: 123 G-IVNMVGFNYIRTPASQYARRLIAEGEIGEVTWFRGEHTEDFYADPAMLASWRTSGMAN 181 Query: 176 ATI-----HDIDSARWFI------EEEIEEVYVRGMNTAPKLGANVWDLQLIQFTTAGGR 224 T+ H I++A I E+E V+ N P + + + +FT GG Sbjct: 182 GTMGDLAPHMINAALALIGPIGAVMAEVETVHT-DRNGTPVTNDDQAQM-MCRFT--GGA 237 Query: 225 LG-----SIETNVVSGYGYEVGVEIVGERGTVQ 252 +G I T GY Y EI G RG ++ Sbjct: 238 MGHLYFSRIATGRKMGYIY----EITGTRGAIR 266 Lambda K H 0.318 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 372 Length adjustment: 29 Effective length of query: 318 Effective length of database: 343 Effective search space: 109074 Effective search space used: 109074 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory