Align Cyclohex-1-ene-1-carbonyl-CoA dehydrogenase; Ch1CoA; EC 1.3.8.10 (characterized)
to candidate 3607889 Dshi_1297 acyl-CoA dehydrogenase domain protein (RefSeq)
Query= SwissProt::Q2LQN9 (414 letters) >FitnessBrowser__Dino:3607889 Length = 387 Score = 258 bits (660), Expect = 2e-73 Identities = 154/380 (40%), Positives = 215/380 (56%), Gaps = 9/380 (2%) Query: 36 ELTEEQKLLMEMVRNLAVREIAPRAIEIDENHSFPVHARDLFADLGLLSPLVPVEYGGTG 95 +L EE + L EMV A + P A E D +++FP +LGLL V YGG G Sbjct: 9 DLGEEVEALREMVHRWAQERVKPLAAETDRSNAFPNALWPEMGELGLLGITVDEAYGGAG 68 Query: 96 MDITTFAMVLEEIGKVCASTALMLLAQADGMLSII-LDGSPALKEKYLPRFGEKSTLMTA 154 M + +EEI + AS L A ++ ++ I L+G+ A KEKYLP+ + A Sbjct: 69 MGYLAHTVAVEEISRASASIGLSYGAHSNLCVNQIKLNGTDAQKEKYLPKL-VSGAHVGA 127 Query: 155 FAATEPGAGSDLLAMKTRAVKKGDKYVINGQKCFITNGSVADILTVWAYTDPSKGAKGMS 214 A +E GAGSD++ MK RA K+ D Y +NG K +ITNG AD L V+A TDP G+KG++ Sbjct: 128 LAMSEAGAGSDVVGMKLRAEKRNDHYRLNGTKYWITNGPDADTLVVYAKTDPEAGSKGIT 187 Query: 215 TFVVERGTPGLIYGHNEKKMGMRGCPNSELFFEDLEVPAENLVGEEGKGFAYLMGALSIN 274 F++E+ G + K+GMRG +EL FED+EVP EN++GEEG+G A LM L Sbjct: 188 AFLIEKEMAGFSTSPHFDKLGMRGSNTAELIFEDVEVPFENVLGEEGRGVAVLMSGLDYE 247 Query: 275 RVFCASQAVGIAQGALERAMQHTREREQFGKPIAHLTPIQFMIADMATEVEAARLLVRKA 334 RV + +GI G L+ M + ER QFG+PI + +Q IADM T + +AR + Sbjct: 248 RVVLSGVNIGIMAGCLDEVMPYMTERRQFGEPIGNFQLMQGKIADMYTAMNSARAYAYEV 307 Query: 335 TTLLDAKDKRGPLI---GGMAKTFASDTAMKVTTDAVQVMGGSGYMQEYQVERMMREAKL 391 D RG + +AS+ MKV AVQ MGG+G++ + V RM R+AKL Sbjct: 308 AKACD----RGEVTRQDAAACVLYASEEGMKVAHQAVQAMGGAGFLNDSPVARMFRDAKL 363 Query: 392 TQIYTGTNQITRMVTGRSLL 411 +I GT++I RM+ GR L+ Sbjct: 364 MEIGAGTSEIRRMLVGRELM 383 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 414 Length of database: 387 Length adjustment: 31 Effective length of query: 383 Effective length of database: 356 Effective search space: 136348 Effective search space used: 136348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory