Align Benzoyl-CoA reductase electron transfer protein, putative (characterized, see rationale)
to candidate 3607905 Dshi_1313 NADH-quinone oxidoreductase, E subunit (RefSeq)
Query= uniprot:Q39TW4 (150 letters) >FitnessBrowser__Dino:3607905 Length = 402 Score = 80.1 bits (196), Expect = 4e-20 Identities = 41/133 (30%), Positives = 73/133 (54%), Gaps = 1/133 (0%) Query: 16 EASSLIQILLDIQSEHNWLPKEALKRVCERLQVPMSRITHIATFYKAFSLVPKGR-HQVH 74 +AS++I IL Q + WL K A++ V + L +P R +ATFY F L P G + Sbjct: 35 QASAIIPILWRAQEQEGWLSKPAIEYVADMLDMPYIRALEVATFYFMFQLQPVGSVAHIQ 94 Query: 75 VCMGTACHVRGAQRVLDTVQEVTGVKSGETDSDLKFSVETVNCLGCCALGPVMEVDGKHH 134 +C T+C + GA+ ++ +E ++ + +D KFS E V CLG CA P+ ++ ++ Sbjct: 95 ICGTTSCMICGAEDLVAVCKEKIAPRAHQLSADGKFSWEEVECLGSCANAPMAQIGKDYY 154 Query: 135 GNIAPSQIASVLN 147 ++ +++L+ Sbjct: 155 EDLTVESFSALLD 167 Lambda K H 0.321 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 150 Length of database: 402 Length adjustment: 23 Effective length of query: 127 Effective length of database: 379 Effective search space: 48133 Effective search space used: 48133 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory