GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaJ2 in Dinoroseobacter shibae DFL-12

Align 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized, see rationale)
to candidate 3610436 Dshi_3817 beta-ketoadipyl CoA thiolase (RefSeq)

Query= uniprot:D8ITH5
         (401 letters)



>lcl|FitnessBrowser__Dino:3610436 Dshi_3817 beta-ketoadipyl CoA
           thiolase (RefSeq)
          Length = 400

 Score =  561 bits (1446), Expect = e-164
 Identities = 279/400 (69%), Positives = 325/400 (81%)

Query: 1   MEALICDAIRTPFGRYGGALGAVRADDLAAAPIRSLMERNPGVDWSRVEDILYGCANQAG 60
           M+A+ICD +RTP GRYGGAL +VRADDLAA PI +LM RNPGVDW+RV++++YG ANQAG
Sbjct: 1   MDAVICDGVRTPIGRYGGALSSVRADDLAALPIAALMARNPGVDWARVDEVIYGAANQAG 60

Query: 61  EDNRNVARMAGLLAGLPIAVPGSTVNRLCGSSLDAVGMAARAIKSGEVQLMIAGGVESMT 120
           EDNRNVARMA LLAGLP  VPG TVNRLC S +DAVG AAR IK+GE  L IAGG+ESM+
Sbjct: 61  EDNRNVARMAALLAGLPEEVPGLTVNRLCASGMDAVGAAARGIKAGEYDLAIAGGIESMS 120

Query: 121 RAPFVMGKAESAFARSAAIFDTTIGWRFVNPLMKAQYGIDSMPETAENVATDFQINRADQ 180
           RAPFVM KAESAF R+A + DTTIGWRFVNP + A +GID+MP+TA+ VA  ++I+RADQ
Sbjct: 121 RAPFVMPKAESAFTRAATVHDTTIGWRFVNPKIAAMHGIDTMPQTADTVAAAYEISRADQ 180

Query: 181 DAFALRSQQRWAAAQAAGFFAGEIAPLTIPQKKGDPLVVTTDEHPRPDTTLATLAKLKGV 240
           DAFA RSQ RWAAA AAG FA EI P+ +PQ+   P++V  DEHPRP T  A LA LKG+
Sbjct: 181 DAFAARSQARWAAADAAGLFADEIVPVPVPQRGSAPILVDRDEHPRPGTDAARLAGLKGI 240

Query: 241 VRPDGTVTAGNASGVNDGACALLLASPKAADLYRLKPRARVLGMATAGVAPRIMGFGPAP 300
             P  +VTAGNASGVNDGA ALL+AS  AA  + L P ARV+GMA+AGVAPR+MG GP P
Sbjct: 241 NGPGLSVTAGNASGVNDGAAALLIASAAAARAHGLTPMARVVGMASAGVAPRVMGIGPVP 300

Query: 301 AVRKVLAQVGLTLAQMDVIELNEAFAAQGLAVMRDLGLPDDAAHVNPNGGAIAIGHPLGA 360
           A RK+L + GLTL QMDVIELNEAFA+Q LA +R LGL DD   VNPNGGAIA+GHPLG 
Sbjct: 301 ASRKLLDRAGLTLDQMDVIELNEAFASQSLATLRQLGLADDDVRVNPNGGAIAMGHPLGM 360

Query: 361 SGARLVTTAINQLERSGGRYALCTMCIGVGQGIALVIERV 400
           SGARLV TA +QL R+GGRYALCTMC+GVGQG AL++ERV
Sbjct: 361 SGARLVLTAAHQLRRTGGRYALCTMCVGVGQGTALILERV 400


Lambda     K      H
   0.320    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 540
Number of extensions: 15
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 401
Length of database: 400
Length adjustment: 31
Effective length of query: 370
Effective length of database: 369
Effective search space:   136530
Effective search space used:   136530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

Align candidate 3610436 Dshi_3817 (beta-ketoadipyl CoA thiolase (RefSeq))
to HMM TIGR02430 (pcaF: 3-oxoadipyl-CoA thiolase (EC 2.3.1.174))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02430.hmm
# target sequence database:        /tmp/gapView.11294.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02430  [M=400]
Accession:   TIGR02430
Description: pcaF: 3-oxoadipyl-CoA thiolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   2.1e-207  674.9  15.8   2.3e-207  674.7  15.8    1.0  1  lcl|FitnessBrowser__Dino:3610436  Dshi_3817 beta-ketoadipyl CoA th


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Dino:3610436  Dshi_3817 beta-ketoadipyl CoA thiolase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  674.7  15.8  2.3e-207  2.3e-207       2     400 .]       2     400 .]       1     400 [] 1.00

  Alignments for each domain:
  == domain 1  score: 674.7 bits;  conditional E-value: 2.3e-207
                         TIGR02430   2 evyivdairtpiGrygGslssvraddlaavplkallarnpsldaaaiddvilGcanqaGednrnvarmaallaGlpv 78 
                                       ++ i+d++rtpiGrygG+lssvraddlaa+p++al+arnp +d+a +d+vi+G+anqaGednrnvarmaallaGlp+
  lcl|FitnessBrowser__Dino:3610436   2 DAVICDGVRTPIGRYGGALSSVRADDLAALPIAALMARNPGVDWARVDEVIYGAANQAGEDNRNVARMAALLAGLPE 78 
                                       578************************************************************************** PP

                         TIGR02430  79 svpgttvnrlcgsgldalglaaraikaGeadlviaGGvesmsrapfvlGkadsafsrsakledttiGwrfvnpklka 155
                                       +vpg tvnrlc+sg+da+g aar+ikaGe dl iaGG+esmsrapfv+ ka+saf+r a ++dttiGwrfvnpk++a
  lcl|FitnessBrowser__Dino:3610436  79 EVPGLTVNRLCASGMDAVGAAARGIKAGEYDLAIAGGIESMSRAPFVMPKAESAFTRAATVHDTTIGWRFVNPKIAA 155
                                       ***************************************************************************** PP

                         TIGR02430 156 lyGvdsmpetaenvaeefgvsredqdafalrsqqrtaaaqakGffaeeivpveikqkkGeetvvdkdehlraettle 232
                                       ++G+d+mp+ta+ va  +++sr+dqdafa rsq+r+aaa+a+G+fa+eivpv ++q+   +  vd+deh+r+ t   
  lcl|FitnessBrowser__Dino:3610436 156 MHGIDTMPQTADTVAAAYEISRADQDAFAARSQARWAAADAAGLFADEIVPVPVPQRGSAPILVDRDEHPRPGTDAA 232
                                       ***************************************************************************** PP

                         TIGR02430 233 alaklkavvredgtvtaGnasGvndGaaalllaseeavkrhgltprarilaaasaGveprvmGlgpvpavkkllara 309
                                       +la lk+++ ++ +vtaGnasGvndGaaall+as+ a+++hgltp ar++++asaGv+prvmG+gpvpa +kll+ra
  lcl|FitnessBrowser__Dino:3610436 233 RLAGLKGINGPGLSVTAGNASGVNDGAAALLIASAAAARAHGLTPMARVVGMASAGVAPRVMGIGPVPASRKLLDRA 309
                                       ***************************************************************************** PP

                         TIGR02430 310 glsledldvielneafaaqalavlrelgladddarvnpnGGaialGhplGasGarlvltalkqleksggryalatlc 386
                                       gl+l+++dvielneafa+q+la+lr+lgladdd rvnpnGGaia+GhplG+sGarlvlta +ql+++ggryal+t+c
  lcl|FitnessBrowser__Dino:3610436 310 GLTLDQMDVIELNEAFASQSLATLRQLGLADDDVRVNPNGGAIAMGHPLGMSGARLVLTAAHQLRRTGGRYALCTMC 386
                                       ***************************************************************************** PP

                         TIGR02430 387 iGvGqGialvierv 400
                                       +GvGqG al++erv
  lcl|FitnessBrowser__Dino:3610436 387 VGVGQGTALILERV 400
                                       *************8 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (400 nodes)
Target sequences:                          1  (400 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 10.68
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory