Align phosphoserine aminotransferase monomer (EC 2.6.1.1; EC 2.6.1.52) (characterized)
to candidate 3609943 Dshi_3325 aminotransferase class V (RefSeq)
Query= metacyc::MONOMER-15919 (385 letters) >FitnessBrowser__Dino:3609943 Length = 422 Score = 235 bits (600), Expect = 2e-66 Identities = 142/387 (36%), Positives = 218/387 (56%), Gaps = 15/387 (3%) Query: 5 AVKKLLMIPGPTMVPPEVLNAMALPVIGHRTKDYSNLLEDTIEKLKKVFITENDTFLITG 64 A + L IPGP+ VP +L A+++ I HR D++++ + ++ +K +F T+ + F+ Sbjct: 31 AGRHFLQIPGPSAVPDRILRAISMQTIDHRGPDFADVGQKALKGMKTIFRTDQNVFIFPS 90 Query: 65 SGTAAMDMAISNIIKRGDKVLNIVTGNFGERFANIVKAYKGEAIRLDVEWGDMAEPEAVK 124 SGT A + A+ N + GD VL TG+F + + K + ++ +W A+P+A++ Sbjct: 91 SGTGAWEAALVNTMSPGDTVLMYETGHFATLWQKMAKKIGLNPVFIEGDWRGGADPQAIE 150 Query: 125 EILDKYDD--IKAVTVVHNETSTGARNPIKEIGEVV--KDYDALYIVDTVSSLGGDYVNV 180 + L K D IKAV VVHNETSTG+ +PI E+ + + AL +VD++S L Sbjct: 151 DALRKDTDHEIKAVCVVHNETSTGSVSPIAEVRAAMDATGHPALLMVDSISGLASVPFEF 210 Query: 181 DKFHIDICVTGSQKCLAAPPGLAAITVSEKAWEVIK--KNDDKVGFYLDLLAYKK--YYE 236 D + +D+CV+GSQK L PPGL+ VS+KA EV K K +LD++ Y+ Sbjct: 211 DAWGVDVCVSGSQKGLMLPPGLSFNAVSDKALEVAKSAKMQRSYWDWLDMVGPNATGYF- 269 Query: 237 EKKQTPYTPSVNLTYALNVALDLVLEEGIENRVKRHERLAKATRAGLEAMGIE-LFAKER 295 PYTP NL Y LN A+D++ EEG+EN +RH R ATRA + A G+E L A++ Sbjct: 270 -----PYTPGTNLLYGLNEAVDMLHEEGLENVFERHRRHGAATRAAVRAWGLEVLCARQG 324 Query: 296 ARSVTVTSAKYPEGIEDSKFRGILSNKYNIVVAGGQKHLAGKIFRIGHMGICGEKEVLAT 355 S +T+ PEG FR Y+I + G +A K+FRIGH+G + ++AT Sbjct: 325 QESGVLTAVMMPEGHSADAFRATTLAHYDISLGNGLSKVADKVFRIGHLGDFNDLMLMAT 384 Query: 356 LACVELALKELGFEVKESGVEVAKEVL 382 L+ VE+ L + G + GV+ A + L Sbjct: 385 LSGVEMGLAKAGVPHESGGVQAAMDHL 411 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 422 Length adjustment: 31 Effective length of query: 354 Effective length of database: 391 Effective search space: 138414 Effective search space used: 138414 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory