Align Cyclohex-1-ene-1-carbonyl-CoA dehydrogenase; Ch1CoA; EC 1.3.8.10 (characterized)
to candidate 3608348 Dshi_1750 acyl-CoA dehydrogenase domain protein (RefSeq)
Query= SwissProt::Q2LQN9 (414 letters) >FitnessBrowser__Dino:3608348 Length = 381 Score = 232 bits (592), Expect = 1e-65 Identities = 137/377 (36%), Positives = 206/377 (54%), Gaps = 6/377 (1%) Query: 37 LTEEQKLLMEMVRNLAVREIAPRAIEIDENHSFPVHARDLFADLGLLSPLVPVEYGGTGM 96 L+EEQ + +M R+ IAP A+ +++ + P A LG V E GG+G+ Sbjct: 5 LSEEQSAIFDMARDFGAENIAPHALAWEKDGTIPKTLWPELAALGFGGLYVTEESGGSGL 64 Query: 97 DITTFAMVLEEIGKVCASTALMLLAQADGMLSIILD--GSPALKEKYLPRFGEKSTLMTA 154 +V E + C S A L M + +LD GS +K ++LP T+ + Sbjct: 65 SRLDATLVFEALSMACPSVAAFL--SIHNMCAAMLDKFGSDDVKARFLPPALTMETVFS- 121 Query: 155 FAATEPGAGSDLLAMKTRAVKKGDKYVINGQKCFITNGSVADILTVWAYTDPSKGAKGMS 214 + TEPG+GSD A+KTRA + + Y + G K FI+ G +D V A T G +G+S Sbjct: 122 YCLTEPGSGSDAAALKTRAERTNEGYRLTGTKAFISGGGYSDAYIVMARTGED-GPRGIS 180 Query: 215 TFVVERGTPGLIYGHNEKKMGMRGCPNSELFFEDLEVPAENLVGEEGKGFAYLMGALSIN 274 + +VE G PGL +G E KMG R P ++ +D VPA NL+GEEG GF Y M L Sbjct: 181 SLIVEDGAPGLSFGGLEDKMGWRAQPTRQVQLDDCAVPAANLLGEEGAGFRYAMMGLDGG 240 Query: 275 RVFCASQAVGIAQGALERAMQHTREREQFGKPIAHLTPIQFMIADMATEVEAARLLVRKA 334 R+ A+ ++G AQ AL+ + + ER FGKPI +QF +AD E++AAR+ +R+A Sbjct: 241 RLNIAACSLGAAQAALDATVAYMGERRAFGKPIDQFQALQFRLADAEIELQAARVFLRQA 300 Query: 335 TTLLDAKDKRGPLIGGMAKTFASDTAMKVTTDAVQVMGGSGYMQEYQVERMMREAKLTQI 394 LD MAK F ++ +V +Q+ GG GY+ +Y +E+++R+ ++ QI Sbjct: 301 AWKLDQGAPDATTHCAMAKKFVTEAGSRVADQCLQLHGGYGYLADYGIEKLVRDLRVHQI 360 Query: 395 YTGTNQITRMVTGRSLL 411 GTN+I R++T R+LL Sbjct: 361 LEGTNEIMRLLTARALL 377 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 414 Length of database: 381 Length adjustment: 31 Effective length of query: 383 Effective length of database: 350 Effective search space: 134050 Effective search space used: 134050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory