Align BadI (characterized)
to candidate 3607896 Dshi_1304 Enoyl-CoA hydratase/isomerase (RefSeq)
Query= metacyc::MONOMER-892 (260 letters) >FitnessBrowser__Dino:3607896 Length = 262 Score = 111 bits (277), Expect = 2e-29 Identities = 81/247 (32%), Positives = 123/247 (49%), Gaps = 11/247 (4%) Query: 13 GVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDRAFCTGGD----Q 68 GV + + RPDK NA EL D V +VL GAG R+FC GGD + Sbjct: 15 GVVTVTLARPDKHNAMNAAMIAELHGLARSLAADAAVRVVVLTGAG-RSFCAGGDLGWMR 73 Query: 69 STHDGNYDGRGTVGLPMEELHTAIRDVPKPVIARVQGYAIGGGNVLATICDLTICSEKAI 128 + + D R + ++ A +PKPVI R+QG A GGG L +CD+ + + A Sbjct: 74 AQMAADPDTRSREARSLAQMLGAWNTLPKPVIGRIQGQAFGGGVGLMAVCDVAVGVQDAR 133 Query: 129 FGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYMCKRYSGKEAEAMGLANLCVPHDELD 188 FG ++G + G +AR +G+ AR ++ + + G EA +GL VP ELD Sbjct: 134 FGLTETRLGLIPATIGPYVVAR-MGQACARRVFMSARLFDGAEAVRLGLLARAVPEAELD 192 Query: 189 AEVQKWGEELCERSPTALAIAKRSFNMD---TAHQAGIAGMGMYALKLYYDTDESREGVK 245 A V+ +P A+A AK + ++ T +A I + AL+ +++DE+ EG+ Sbjct: 193 AAVEAEVAPYLAVAPGAVAAAK-ALTLELGGTVTEAQIDAT-VAALRERWESDEAAEGIA 250 Query: 246 ALQEKRK 252 A +KRK Sbjct: 251 AFFDKRK 257 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 262 Length adjustment: 25 Effective length of query: 235 Effective length of database: 237 Effective search space: 55695 Effective search space used: 55695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory