Align High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)
to candidate 3610347 Dshi_3728 ABC transporter related (RefSeq)
Query= uniprot:A0A159ZWL6 (233 letters) >FitnessBrowser__Dino:3610347 Length = 236 Score = 183 bits (464), Expect = 3e-51 Identities = 93/215 (43%), Positives = 140/215 (65%) Query: 1 MLQFENVSTFYGKIQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCGSPQAHSGSIRY 60 ML EN+ + YG + V+++V +GEI+ + G NG GK+TLL + G + SGSIR Sbjct: 5 MLSIENLHSHYGLSHVIQGVSLDVGRGEILGVFGRNGVGKTTLLKNIAGWVKPSSGSIRM 64 Query: 61 MGEELVGQDSSHIMRKSIAVVPEGRRVFARLTVEENLAMGGFFTDKGDYQEQMDKVLHLF 120 G+++ G + I R +A+VPE RR+F LTV+ENL +G + ++D VL F Sbjct: 65 DGKQIGGDEPDAINRAGLAIVPEDRRIFPGLTVQENLELGLLGLKGPKPRSKLDPVLERF 124 Query: 121 PRLKERFTQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFDIIEQLR 180 PRL ER Q T+SGGEQQMLA+ R ++++P+ +L+DEPS GLAP+I+ +IF I+ +++ Sbjct: 125 PRLAERAQQPATTLSGGEQQMLAMARIMVAEPRAVLIDEPSEGLAPMIVAEIFAILREMK 184 Query: 181 KDGVTVFLVEQNANQALKIADRAYVLENGRVVMQG 215 G + LVEQN ++AL I DR ++E G +V +G Sbjct: 185 DAGCAIVLVEQNIHEALSICDRFVLVERGAIVFEG 219 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 236 Length adjustment: 23 Effective length of query: 210 Effective length of database: 213 Effective search space: 44730 Effective search space used: 44730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory