Align Branched-chain amino acid ABC transporter permease LivH; SubName: Full=Branched-chain amino acid transporter permease subunit LivH; SubName: Full=L-leucine ABC transporter membrane protein /L-isoleucine ABC transporter membrane protein /L-valine ABC transporter membrane protein (characterized, see rationale)
to candidate 3608585 Dshi_1979 inner-membrane translocator (RefSeq)
Query= uniprot:A0A0D9B2B6 (307 letters) >FitnessBrowser__Dino:3608585 Length = 305 Score = 129 bits (325), Expect = 7e-35 Identities = 93/301 (30%), Positives = 156/301 (51%), Gaps = 12/301 (3%) Query: 9 QQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVAFI--AIAGLAMMGLD 66 Q L++G+ VG+ +L AIG T+ ++ NF+H E+ IG+Y A + A+ + L Sbjct: 3 QHLLDGILVGAILSLGAIGLTLTMHMLRFANFSHAELLSIGAYAALVFDALFSALLPALQ 62 Query: 67 SV--PLLMT----AAFIASIVVTSSYGYSIERIAYRPLRGSNRLIPLISA-IGMSIFLQN 119 + PL +T A +AS+ +T +I+R+ ++ +R + ++ A G+++ ++N Sbjct: 63 TAIPPLSLTWTLSLATVASMALTGLSAIAIDRLIFKRVREKGGELSMVFASFGVAMVIRN 122 Query: 120 TVLLSQDSKDKSIPNLIPGNFAIGPGGAHEVLISYMQIVVFVVTLVAMLGLTLFISRSRL 179 + L + + I FA +L+ Q+ V L M+ L L +SR+ Sbjct: 123 LIGLGFGLNTQLYSDDIV--FATVLSRDPLILVKPDQVFTLVAALAIMVVLHLVLSRTTF 180 Query: 180 GRACRACAEDIKMANLLGINTNNIIALTFVIGAALAAIAAVLLSMQYGVINPNAGFLVGL 239 G + RA AE+ +A + GIN ++AL +++G LAA A V + I P G + L Sbjct: 181 GYSLRAVAENPVLAQVSGINLQRMVALIWILGGTLAAAAGVFYGLT-NQITPVIGRDLVL 239 Query: 240 KAFTAAVLGGIGSIPGAMLGGLVLGVAEAFGADIFGDQYKDVVAFGLLVLVLLFRPTGIL 299 F A ++GGIGSI GA+LGG ++G+A + Y V F +LV VL+ RP G+ Sbjct: 240 PIFAATIVGGIGSIYGAVLGGFLVGIAANLALVVLPSGYSPSVPFLILVAVLVLRPHGLF 299 Query: 300 G 300 G Sbjct: 300 G 300 Lambda K H 0.327 0.144 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 305 Length adjustment: 27 Effective length of query: 280 Effective length of database: 278 Effective search space: 77840 Effective search space used: 77840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory