Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate 3609926 Dshi_3308 Glutathione S-transferase domain (RefSeq)
Query= reanno::acidovorax_3H11:Ac3H11_2306 (222 letters) >FitnessBrowser__Dino:3609926 Length = 221 Score = 54.3 bits (129), Expect = 2e-12 Identities = 35/84 (41%), Positives = 45/84 (53%), Gaps = 3/84 (3%) Query: 24 LAYDYLPVHLVKGEHKAP--EYASRIGDALVPTLVTDGGTALSQSMAIIEYLDETHPTPA 81 LA + V LV ++ P ++ R VP L GGT L++S AI+EYL+E HPTPA Sbjct: 20 LAEKKIEVELVDEKYWEPSADFLRRNPAGKVPVLKM-GGTHLTESHAIVEYLEELHPTPA 78 Query: 82 LLPATPLARARVRALAQMVACEIH 105 LLP TP R R L + H Sbjct: 79 LLPGTPQDRFEARRLVMWFDDKFH 102 Lambda K H 0.323 0.136 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 221 Length adjustment: 22 Effective length of query: 200 Effective length of database: 199 Effective search space: 39800 Effective search space used: 39800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory