Align ring 1,2-phenylacetyl-CoA epoxidase PaaE subunit (EC 1.14.13.149) (characterized)
to candidate 3610441 Dshi_3822 phenylacetate-CoA oxygenase/reductase, PaaK subunit (RefSeq)
Query= metacyc::MONOMER-15950 (357 letters) >FitnessBrowser__Dino:3610441 Length = 356 Score = 355 bits (910), Expect = e-102 Identities = 184/358 (51%), Positives = 241/358 (67%), Gaps = 6/358 (1%) Query: 1 MSKFHSLTIKEVRPETRDAVSIAFDVPAELADSFRFTQGQHLVMRTQLDGEEVRRSYSIC 60 M++FH L++ +VR RDAV + P + D F F QGQ+L R DG E+RRSYSIC Sbjct: 1 MARFHPLSVTDVRKTIRDAVVVTLK-PVDGGD-FGFIQGQYLTFRRSFDGTELRRSYSIC 58 Query: 61 TGVNDGELRVAIKRVAGGRFSAYANESLKAGQRLEVMPPSGHFHVELDAARHGNYLAVAA 120 G +DG L+V IKRV GG FS +AN+SL G LE M P G FH LD NYLA A Sbjct: 59 AGRDDGVLQVGIKRVEGGAFSTWANDSLAPGMTLEAMAPMGSFHTPLDPHTPRNYLAFAG 118 Query: 121 GSGITPILSIIKTTLETEPHSRVTLLYGNRSSASTLFREQLEDLKNRYLQRLNLIFLFSR 180 GSGITPILSI+KT L EP SR+TL+Y NR + +FRE+LEDLKN ++ RL +I + Sbjct: 119 GSGITPILSILKTVLAREPGSRLTLVYANRGVNTIMFREELEDLKNLHMGRLTVIHVLES 178 Query: 181 EQQDVDLYNGRIDADKCGQLFSRWIDVKALDAAFICGPQAMTETVRDQLKANGMAAERIH 240 + Q++DL+ GR+D KC LF+ WID+ ++D AFICGP+ M + L+A+GM +RI Sbjct: 179 DAQEIDLFTGRVDGAKCDALFAHWIDIDSIDTAFICGPEPMMLGIAAALRAHGMTDDRIK 238 Query: 241 FELFAAAGSAQKREARESAA---QDSSVSQITVISDGRELSFELPRNSQSILDAGNAQGA 297 FELFA+ + +AA ++ + TV DG SF + ++ QSILDA A Sbjct: 239 FELFASGQPGRLPRKPGAAAGHDPEARATAATVTMDGAARSFAMDKD-QSILDAALANAL 297 Query: 298 ELPYSCKAGVCSTCKCKVVEGEVEMDSNFALEDYEVAAGYVLSCQTFPISDKVVLDFD 355 + PY+CKAGVCSTCKCKV+EGEVEM +N ALEDYEVA GYVLSCQ++P++D+VV+ +D Sbjct: 298 DAPYACKAGVCSTCKCKVLEGEVEMIANHALEDYEVARGYVLSCQSYPVTDRVVVTYD 355 Lambda K H 0.319 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 357 Length of database: 356 Length adjustment: 29 Effective length of query: 328 Effective length of database: 327 Effective search space: 107256 Effective search space used: 107256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory