Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate 3608199 Dshi_1604 Enoyl-CoA hydratase/isomerase (RefSeq)
Query= BRENDA::P76082 (255 letters) >FitnessBrowser__Dino:3608199 Length = 264 Score = 124 bits (311), Expect = 2e-33 Identities = 86/257 (33%), Positives = 132/257 (51%), Gaps = 9/257 (3%) Query: 4 LIVSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFAAGA 63 L+ S + LTLN P + N L++A+L L +++ A D + V V+ G R F AG Sbjct: 6 LLRSDADGIATLTLNAPQSLNVLSDAMLAALQAQIDTLAEDRTTRVVVLRGAGRAFCAGH 65 Query: 64 DLNEM-----AEKDLAAT---LNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCD 115 DL EM +E AA L D ++ LQA +P+IA V+G A AGC+L D Sbjct: 66 DLKEMTAARQSEDGGAAAFKDLFDRCARMMMGLQALPQPVIAQVHGIATAAGCQLVATAD 125 Query: 116 VVVAGENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVS 175 + VA E ARFG+ + +G+ L R++ + A +++ +GE I AQ+AQ GLV+ Sbjct: 126 MAVAAEGARFGVNGVNIGLFCSTPMVA-LSRNIPRKQAFELLTTGEMIEAQKAQALGLVN 184 Query: 176 DVFPSDLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATE 235 V P++ LA+K+A + K+A + +++L A + A Sbjct: 185 RVVPTEDLEAETNALATKVAEKRGAVVAIGKRAFYEQSQMSLADAYAFTGNVMVKNMALR 244 Query: 236 DRHEGISAFLQKRTPDF 252 D EGI+AFL KR P++ Sbjct: 245 DTEEGIAAFLDKRPPNW 261 Lambda K H 0.318 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 112 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 264 Length adjustment: 24 Effective length of query: 231 Effective length of database: 240 Effective search space: 55440 Effective search space used: 55440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory