GapMind for catabolism of small carbon sources


Aligments for a candidate for paaK in Dinoroseobacter shibae DFL-12

Align phenylacetate-CoA ligase (EC (characterized)
to candidate 3610443 Dshi_3824 phenylacetate-CoA ligase (RefSeq)

Query= BRENDA::B4E7B5
         (432 letters)

>lcl|FitnessBrowser__Dino:3610443 Dshi_3824 phenylacetate-CoA ligase
          Length = 436

 Score =  573 bits (1476), Expect = e-168
 Identities = 280/425 (65%), Positives = 336/425 (79%), Gaps = 1/425 (0%)







           LD + + VE  P  A D  +   A + L   ++ ++GV+  + V     + RS GKA RV

Query: 427 VDKRK 431
           +D RK
Sbjct: 430 IDNRK 434

Lambda     K      H
   0.319    0.137    0.404 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 630
Number of extensions: 10
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 432
Length of database: 436
Length adjustment: 32
Effective length of query: 400
Effective length of database: 404
Effective search space:   161600
Effective search space used:   161600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

Align candidate 3610443 Dshi_3824 (phenylacetate-CoA ligase (RefSeq))
to HMM TIGR02155 (paaF: phenylacetate-CoA ligase (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02155.hmm
# target sequence database:        /tmp/gapView.2350.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02155  [M=422]
Accession:   TIGR02155
Description: PA_CoA_ligase: phenylacetate-CoA ligase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   2.7e-210  684.2   0.1   3.1e-210  684.0   0.1    1.0  1  lcl|FitnessBrowser__Dino:3610443  Dshi_3824 phenylacetate-CoA liga

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Dino:3610443  Dshi_3824 phenylacetate-CoA ligase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  684.0   0.1  3.1e-210  3.1e-210       1     422 []      15     433 ..      15     433 .. 0.99

  Alignments for each domain:
  == domain 1  score: 684.0 bits;  conditional E-value: 3.1e-210
                         TIGR02155   1 eklsldelralqlerlkvsvkrayenvpayrkafdaagvkpddlkelsdlakfpltaksdlrdnypfdllavprekv 77 
                                       e +s+de+ alql+r+k+s+++ay+nvp+yr++fdaagv+pddl++l+dlakfp+t+ksdlrd ypf++ avpr+++
                                       679************************************************************************** PP

                         TIGR02155  78 vrvhassGttGkptvvaytqkdldtwsevvarslraaGGrkgdllhnayGyGlftGGlGvhyGaeklGatvvpisGG 154
                                       vrvhassGttGkptvv yt++d+++w++ +arslra+G r+gd++hnayGyGlftGGlG+hyG eklGatv+p+ GG
                                       ***************************************************************************** PP

                         TIGR02155 155 qtekqvqliqdfkpdiiavtpsyilalleelkrlgidpedislkvailGaepwteamrkelearlgikaldiyGlse 231
                                       qtekqv li+df+p  i+vtpsy+l++le +++ g+dp++ sl+v+++Gaepwt+amr+e+e++++++a+diyGlse
                                       ***************************************************************************** PP

                         TIGR02155 232 viGpGvanecvetkdGlviwedhfypeiidpetgevlpdGeeGelvfttltkealpviryrtrdltrllpgtartmr 308
                                       v+GpGvanecvetkdGl++wedh+ypeiidp+tgevl dG eGelvfttltke++p+iryrtrdltrllpgtar+mr
                                       ***************************************************************************** PP

                         TIGR02155 309 rmdkikGrsddllilrGvnvfptqleevllkldklsphyqleltreGaldeltlkvelkdesaalrlleqksllakk 385
                                       r++ki+Grsdd++ilrGvnvfptq+ee +++++ l+p +q+el  +G+ld + + ve+ + +a+     ++++ a+ 
                                       ***********************************************************9887776...55566899 PP

                         TIGR02155 386 iekkikaevgvsvdvelvepgslerseGkakrvvdkr 422
                                       + k+++++vgvs++v + +pgs+ rs+Gka rv+d+r
  lcl|FitnessBrowser__Dino:3610443 397 LTKHVRDMVGVSIEVVVGDPGSVARSQGKAVRVIDNR 433
                                       9**********************************98 PP

Internal pipeline statistics summary:
Query model(s):                            1  (422 nodes)
Target sequences:                          1  (436 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.02s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 6.60

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory