Align Enoyl-CoA hydratase; EC 4.2.1.17 (characterized, see rationale)
to candidate 3608351 Dshi_1753 Enoyl-CoA hydratase/isomerase (RefSeq)
Query= uniprot:A0A2Z5MCI7 (262 letters) >FitnessBrowser__Dino:3608351 Length = 258 Score = 93.2 bits (230), Expect = 5e-24 Identities = 77/256 (30%), Positives = 121/256 (47%), Gaps = 12/256 (4%) Query: 11 TESESTLVLTLSNPGARNALHPDMYAAGIEALDSVE-RDPSIRAVVITGADNFFCAGGNL 69 T + VLTL+ P NAL+ M A E D+V+ R +V+TGA FC+G +L Sbjct: 9 TIEDDAAVLTLNRPDVMNALNSQMRA---EITDAVKLAGAEARVLVMTGAGRAFCSGQDL 65 Query: 70 NRLLENRAKDPSVQAQSIDLLAEWISALRL---SSKPVIAAVDGAAAGAGFSLALACDLI 126 +RA ++ + L E++ LR P IAAV+G AAGAG +LALA D++ Sbjct: 66 G----DRANAANLDLERT-LRDEYVPMLRAIFDCPVPTIAAVNGPAAGAGANLALAADVV 120 Query: 127 VAADDAKFVMSYARVGLTPDGGGSWFLAQALPRQLATEVLIEGKPIGAARLHELGVVNKL 186 +A + A F+ ++ R+GL PD GG+++L + + A + I A + G++ + Sbjct: 121 IATESAVFLQAFTRIGLIPDAGGTYWLPRQMGFAKAMGAALFADKITARQADAWGMIWEA 180 Query: 187 TKPGTARDAAVAWADELGKISPNSVARIKTLVCAAGTQPLSEHLVAERDNFVASLHHREG 246 A A L K + +K + + L L E R+ Sbjct: 181 VPDAEFEAVWRARAAHLAKGPTAAYEAVKQALRDSFNNDLDGQLALEAKLQGKMGETRDF 240 Query: 247 LEGISAFLEKRAPVYK 262 EG+ AFLEKR+ ++ Sbjct: 241 KEGVLAFLEKRSASFE 256 Lambda K H 0.317 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 258 Length adjustment: 24 Effective length of query: 238 Effective length of database: 234 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory