Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate 3607448 Dshi_0861 inner-membrane translocator (RefSeq)
Query= uniprot:D8IUY4 (309 letters) >FitnessBrowser__Dino:3607448 Length = 305 Score = 132 bits (331), Expect = 1e-35 Identities = 93/312 (29%), Positives = 152/312 (48%), Gaps = 23/312 (7%) Query: 3 IFIQQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQVAP 62 + I+Q++NGL G M L+A G T+V+GV+ LIN AHG + MVGA ++ Sbjct: 5 LLIEQVLNGLQFGVMLFLMAAGLTLVFGVMGLINLAHGSLYMVGAFAAAAV--------A 56 Query: 63 GLPGIVQLVIAIVGAIPVCIVVSLLIERIAYRPLRNAPRLAPLITAIGVSILLQTLAMMI 122 G G V+ + A+ LIE R L L ++ + ++ I Sbjct: 57 GATG--SFVLGLAAALAAAAAAGALIEVTIIRRLYARDHLDQVLATFALILIFSEGTRWI 114 Query: 123 WGRSP--LPFPQVMPSDPVHIAGALISPT-QIMLLALAVLAMVGLVLIVEKTKMGRAMRA 179 +G P L P + S PV + + P ++ ++ + + L ++ KT++G +RA Sbjct: 115 FGSFPLFLEVPAAL-SGPVTLPFGIEYPAYRLAIIGIGLAIAAALFWLIAKTRIGVQIRA 173 Query: 180 TAENPRIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAFSAA 239 + + +GVD +++ + FA+GA LA +AG + A + Q MG + AF Sbjct: 174 GEADREMIAALGVDIDRLYTLVFALGAALAGLAGALVGA-LQSVQVGMGEPVLILAFVVI 232 Query: 240 VLGGIGNIYGAMLGGILLGLIESLGAGYIGDLTGNFL--------GSNYQDIFAFIVLII 291 V+GGIG+I GA +G +LLGL ++LG + G L GS + +I++ Sbjct: 233 VIGGIGSIKGAFVGALLLGLTDTLGRTLLPVAFGTVLEPSMATAVGSALASMAIYILMAG 292 Query: 292 VLTLRPSGIMGE 303 VL RPSG+ G+ Sbjct: 293 VLIFRPSGLFGQ 304 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 305 Length adjustment: 27 Effective length of query: 282 Effective length of database: 278 Effective search space: 78396 Effective search space used: 78396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory