Align Glycine betaine/proline betaine transporter BetS (characterized)
to candidate 3607157 Dshi_0579 BCCT transporter (RefSeq)
Query= SwissProt::G3XCN6 (706 letters) >FitnessBrowser__Dino:3607157 Length = 519 Score = 247 bits (631), Expect = 9e-70 Identities = 159/485 (32%), Positives = 248/485 (51%), Gaps = 20/485 (4%) Query: 58 FVGSVAVIALFVGIGVIAPKRAESIFSGMQTAILSGFGWLYLLSVAVFLFSMLFLAFSRY 117 F+ ALF G+ A FS A G W LL +A FL ++ Sbjct: 26 FIALFCAYALFDIEGLSALVDTSFAFS----AKYFGLYWQVLL-LATFLIGLVLCFLP-- 78 Query: 118 GELKLGPDDSEPEFRYLSWIAMLFAAGMGIGLMYFAVGEPMTHFAS-PPEAEPLTIAAQR 176 G L S PEF SW AM+ + G +++A GEP+ HF S PP L+ Q Sbjct: 79 GSRTLMGGLSTPEFGTFSWAAMIMCTLLAGGGVFWAAGEPIAHFLSTPPVFGDLSGDVQA 138 Query: 177 EA---MSVTFFHWGVHAWAIY-SVVGLSLAYFGYRYNLPLTVRSGLYPLLKE-GIHGPIG 231 +A ++ +F HWG AWAI S+ + L ++ Y LPL R+ LYPLL + + GPIG Sbjct: 139 QAHAALAQSFLHWGFLAWAILGSLTTVMLMHYHYDKGLPLAPRTLLYPLLGDRALSGPIG 198 Query: 232 HVVDIFAICGTMFGLATSLGFGILQINSGLNYLLGIPQSIYVQLLLVTVVTAIATISVVT 291 + D I + G +GF LQ++ GLN L GIP + Q + + + + T+S +T Sbjct: 199 LIADASCIIAVVAGTVGPIGFLGLQMSYGLNDLTGIPDTFATQAIAILALVGLYTVSAIT 258 Query: 292 GVEKGVRILSETNLFLAVLLMLFVLVVGPTGTLMRDFVQNIGLYLD---SLVLRTFNIYA 348 G+ KG++ILS+ N+ LAV+L++F+LV GPT + F + +Y + + + Sbjct: 259 GLAKGIKILSQINVLLAVVLLIFMLVAGPTMNIFAGFFGGMQVYATHFFDMAMYRGDAGL 318 Query: 349 YEPRPWIDSWTLFYWAWWISWSPFVGMFIARISRGRTVREFVTAVLFVPAMFTFLWMTVF 408 + W+ WT+F+W W++ + P + +FIARISRGR++R+ + + + T W T+ Sbjct: 319 FGDAGWLGWWTVFFWGWFMGYGPLMAVFIARISRGRSIRQIIITLSIAAPLITNFWFTII 378 Query: 409 GNTAIYVDTTIANGELARDVKADLSVALFQFFEYLPWPAVTSTLAVLLVSIFFVTSSDSG 468 G + I+ + +L L + +P + S L ++L F T+SDS Sbjct: 379 GGSGIFFEIAEPGVVSGPFEGFNLPAGLLAITQAMPMGLILSVLFLVLTMCFVATTSDSM 438 Query: 469 SLVIDTIASGGETATPALQRIFWCSLSGIVAAVLLST--GGLTALQSATISTALPFSLVM 526 S VI + + GE +T R FW G++A +L+ST GG+ LQS + TA+P SL++ Sbjct: 439 SYVISSTMTDGEPST--AMRAFWGLAMGVMALILISTGEGGIGKLQSFIVVTAVPVSLIL 496 Query: 527 LILVW 531 L +W Sbjct: 497 LPSLW 501 Lambda K H 0.326 0.139 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1018 Number of extensions: 65 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 706 Length of database: 519 Length adjustment: 37 Effective length of query: 669 Effective length of database: 482 Effective search space: 322458 Effective search space used: 322458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory