Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate 3607646 Dshi_1055 ABC transporter related (RefSeq)
Query= TCDB::Q9KKE1 (275 letters) >FitnessBrowser__Dino:3607646 Length = 366 Score = 179 bits (454), Expect = 8e-50 Identities = 98/227 (43%), Positives = 136/227 (59%), Gaps = 6/227 (2%) Query: 38 GCTVGLNDVSLKIGAGKIFVIMGLSGSGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAK 97 G L V L I AG+ FV++G SG GK+TL+R I PT G+VL G ++ L Sbjct: 19 GPVKALRQVDLTIAAGEYFVLLGPSGGGKTTLLRTIGGFHRPTEGQVLLHGRDMSHLPPD 78 Query: 98 ALRAFRMRRVSMVFQSFALMPHRTVLQNVVYGQRVRGVSKDDAREIGMKWIDTVGLSGYD 157 R +MVFQ++AL PH TVLQNV YG +V G+ K A+E +D VGL+G+ Sbjct: 79 K------RPTTMVFQAYALFPHMTVLQNVSYGLKVAGMDKATAQEKAAAMMDVVGLAGFA 132 Query: 158 AKFPHQLSGGMKQRVGLARALAADTDVILMDEAFSALDPLIRGDMQDQLLQLQRNLAKTI 217 + PH+LSGG +QRV LARAL D D++L+DE +ALD +R DM +L LQ + T Sbjct: 133 ERKPHELSGGQQQRVQLARALVLDRDILLLDEPLAALDAQLRKDMCLELKHLQEKVGITF 192 Query: 218 VFITHDLDEALRIGSEIAILRDGQVVQVGTPNDILDNPANDYVARFV 264 + +TH+ +EA+ + IA++ DGQ+V+ G DI P + A FV Sbjct: 193 IHVTHNQEEAMTVADRIALVADGQLVEQGAARDIYRAPIKKFTAGFV 239 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 366 Length adjustment: 27 Effective length of query: 248 Effective length of database: 339 Effective search space: 84072 Effective search space used: 84072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory