Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate 3610800 Dshi_4186 ABC transporter related (RefSeq)
Query= TCDB::Q9KKE1 (275 letters) >FitnessBrowser__Dino:3610800 Length = 273 Score = 157 bits (397), Expect = 2e-43 Identities = 100/274 (36%), Positives = 146/274 (53%), Gaps = 38/274 (13%) Query: 4 IEIRNVYKIF----GHDAKKALTMVEDGLDKADILSRSGCTVGLNDVSLKIGAGKIFVIM 59 IE+R + K F DA+K L + DG+D L I G+ I+ Sbjct: 11 IELRGIRKTFTLSEDRDAQKVLAL--DGID------------------LTIRQGEFLTII 50 Query: 60 GLSGSGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAFRMRRVSMVFQSFALMPH 119 G SG GK+TL++ I LI G+V+ +G + + +MVFQ+F L P Sbjct: 51 GPSGCGKTTLLKIIASLISHDEGDVVVEGKPVHEPDISR---------AMVFQTFGLFPW 101 Query: 120 RTVLQNVVYGQRVRGVSKDDAREIGMKWIDTVGLSGYDAKFPHQLSGGMKQRVGLARALA 179 +TV+ NV + VR + +AREI MK I+ VGL + +PHQLSGGM+QRVGLARAL+ Sbjct: 102 KTVIDNVTFPLTVRNFAPAEAREIAMKHIEQVGLGKFVDAYPHQLSGGMQQRVGLARALS 161 Query: 180 ADTDVILMDEAFSALDPLIRGDMQDQLLQLQRNLAKTIVFITHDLDEALRIGSEIAILRD 239 D++LMDE F A+D R MQ++L+++ + KT+VFITHDLDEA+ + + ++ Sbjct: 162 TGADILLMDEPFGAIDAQTRELMQEELMRICQREQKTVVFITHDLDEAVLLADRVLLMSR 221 Query: 240 G-----QVVQVGTPNDILDNPANDYVARFVQRRH 268 G +V+ V P D + + R H Sbjct: 222 GPGRVREVIDVDLPRPRFDYDVRGHASFIKVRGH 255 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 273 Length adjustment: 25 Effective length of query: 250 Effective length of database: 248 Effective search space: 62000 Effective search space used: 62000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory