Align BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized)
to candidate 3608030 Dshi_1437 glycine betaine/L-proline ABC transporter, ATPase subunit (RefSeq)
Query= TCDB::Q9RQ06 (407 letters) >FitnessBrowser__Dino:3608030 Length = 351 Score = 291 bits (744), Expect = 3e-83 Identities = 162/354 (45%), Positives = 226/354 (63%), Gaps = 16/354 (4%) Query: 5 VKIEHLTKIFGKRIKTALTMV-EQGEPKNEILKKTGATVGVYDTNFEINEGEIFVIMGLS 63 ++I ++ KIFG + AL V ++G K EIL + A VGV D + + GEIF IMGLS Sbjct: 7 IEISNVWKIFGANAQAALEAVRDRGLSKAEILAEFNAVVGVADVSLSVRRGEIFCIMGLS 66 Query: 64 GSGKSTLLRLLNRLIEPTSGKIFIDDQDVATLNKEDLLQVRRKSMSMVFQNFGLFPHRTI 123 GSGKSTL+R NRL+EPT+G+I I+ DV L ++L + R + + MVFQNF L PHR++ Sbjct: 67 GSGKSTLVRHFNRLLEPTAGRIEIEGTDVMALGTQELQRFRNRQIGMVFQNFALMPHRSV 126 Query: 124 LENTEYGLEVQNVPKEERRKRAEKALDNANLLDFKDQYPKQLSGGMQQRVGLARALANDP 183 L+N LE++ VPK ER ++A LD L + ++ +L GGMQQRVGLARALA +P Sbjct: 127 LDNVAMPLEIRKVPKNERMRQAAAILDIVELGAWGAKFAHELPGGMQQRVGLARALAANP 186 Query: 184 EILLMDEAFSALDPLIRREMQDELLELQAKFQKTIIFVSHDLNEALRIGDRIAIMKDGKI 243 ++LLMDE FSALDPLIRR++QDE + L +KT IF++HDL+EA+RIGDRIAIM+DGK+ Sbjct: 187 DVLLMDEPFSALDPLIRRQLQDEFIRLSKILKKTTIFITHDLDEAVRIGDRIAIMRDGKV 246 Query: 244 MQIGTGEEILTNPANDYVKTFVEDVDRAKVITAENIMIPALTTNIDVDGPSVALKKMKTE 303 +Q+GT E+I+ +PA+DYV FV + R KV+ A +M P L + GP A Sbjct: 247 VQMGTAEDIVMHPADDYVADFVAGISRLKVVHAHAVMQP-LEAYLATHGPLPA------- 298 Query: 304 EVSSLMAVDRKRQFRGVVTSEQAIAARKNNQSLKDVMTTDVGTVTKEMLVRDIL 357 ++ VD ++T +A N L DVG +T+ L+R ++ Sbjct: 299 ---AVPKVDEGETLSNLIT----LAIDDENPILVQDAGRDVGIITRADLLRTVI 345 Lambda K H 0.316 0.135 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 407 Length of database: 351 Length adjustment: 30 Effective length of query: 377 Effective length of database: 321 Effective search space: 121017 Effective search space used: 121017 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory