Align glycine betaine/l-proline transport atp-binding protein prov (characterized)
to candidate 3607124 Dshi_0546 ABC transporter related (RefSeq)
Query= CharProtDB::CH_001555 (400 letters) >FitnessBrowser__Dino:3607124 Length = 338 Score = 171 bits (432), Expect = 4e-47 Identities = 94/249 (37%), Positives = 148/249 (59%), Gaps = 7/249 (2%) Query: 28 GLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLI 87 G+ ++I + G + + D +L IE+GE V +G SG GKST++R L L + G++ I Sbjct: 3 GIKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRIEI 62 Query: 88 DGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGINAEERREKALD 147 G D+ + A+ + +AMVFQS+AL PHMTV +N FGM++ G + R+E+ + Sbjct: 63 GGRDVTTVEPAD------RDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAE 116 Query: 148 ALRQVGLENYAHSYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDEL 207 A R + LE+Y P +LSGG RQRV + RA+ NP + L DE S LD +R +M+ EL Sbjct: 117 AARVLQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVEL 176 Query: 208 VKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRG 267 L + T+++++HD EAM + D+I ++ G + QVG+P ++ + P + +V F G Sbjct: 177 EGLHKQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFI-G 235 Query: 268 VDISQVFSA 276 VFS+ Sbjct: 236 SPAMNVFSS 244 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 338 Length adjustment: 30 Effective length of query: 370 Effective length of database: 308 Effective search space: 113960 Effective search space used: 113960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory