Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate 3608192 Dshi_1597 ABC transporter related (RefSeq)
Query= TCDB::P31134 (377 letters) >FitnessBrowser__Dino:3608192 Length = 355 Score = 261 bits (666), Expect = 3e-74 Identities = 150/357 (42%), Positives = 216/357 (60%), Gaps = 14/357 (3%) Query: 18 PLLEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIM 77 PL+ I+N+ K Y HA+ DVS+ I GE F+LLG SGCGK+TLLR +AGFE+ +G + Sbjct: 4 PLIRIQNVQKYYGSYHALRDVSVDIGAGEFFSLLGPSGCGKTTLLRTIAGFEEFESGTLT 63 Query: 78 LDGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQ-DKLPKAEIASRVNEMLGL 136 L GVD+ VP RP NM+FQSYA+FPH++V N+ FGL++ L AS V + L + Sbjct: 64 LGGVDMVGVPANKRPTNMVFQSYAIFPHLSVGDNVGFGLRRRTDLTGEARASLVADALHM 123 Query: 137 VHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDIL 196 V ++ + R H LSGGQRQRVALAR+L +PK+LLLDEP+ ALDKK+R++MQ E+ + Sbjct: 124 VGLKGYGARAAHALSGGQRQRVALARALVLKPKVLLLDEPLSALDKKMREQMQTELRRLQ 183 Query: 197 ERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVF 256 VG+T ++VTHDQEEA+TM+ RIA+M G+ Q+ P+ +Y P +R AEFIG+++ Sbjct: 184 RHVGITFILVTHDQEEALTMSDRIAVMFEGRIAQLAPPQTLYAQPASRAVAEFIGTMSFL 243 Query: 257 EGVLKERQEDGLVLDSPGLVHPLKVDADASVVDNVPVHVALRPEKIMLCEEPPANGCNFA 316 + + D L + P+ D A V +RPE + L + G Sbjct: 244 PAEISGDRADVAGLGTV----PVTADQCAEGATGTCV-AGVRPEGMALDFDETGQG---T 295 Query: 317 VGEVIHIAYLGDLSVYHVRLKSGQMISAQLQNAHRHRKGLPTW--GDEVRLCWEVDS 371 GEV+ Y GD++ YHVRL + ++ A ++ G+P G R+ W ++ Sbjct: 296 PGEVVEREYFGDMTSYHVRLDGTDRL---VEIAMKNGPGIPVLDPGARTRVQWSPEA 349 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 355 Length adjustment: 30 Effective length of query: 347 Effective length of database: 325 Effective search space: 112775 Effective search space used: 112775 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory