Align Monocarboxylate 2-oxoacid-binding periplasmic protein all3028; Extracellular solute-binding protein; Extracytoplasmic solute receptor protein all3028; TRAP transporter monocarboxylate 2-oxoacid-binding subunit P (characterized)
to candidate 3608577 Dshi_1971 TRAP dicarboxylate transporter- DctP subunit (RefSeq)
Query= SwissProt::Q8YSQ6 (364 letters) >FitnessBrowser__Dino:3608577 Length = 325 Score = 202 bits (515), Expect = 8e-57 Identities = 106/296 (35%), Positives = 166/296 (56%), Gaps = 3/296 (1%) Query: 58 VAKRVAEMTNGRFKITPFAAGELVPGLQVLDAVQAGTVECGHTSSYYYIGKSPALAFATS 117 VA +A M+ G K+ + G+LVP ++LDAV +G + G+T++ Y+ GK PA ++ Sbjct: 23 VADALATMSGGTLKMKVYEPGKLVPAFEILDAVSSGKINSGYTTAGYWAGKIPAAPLFSA 82 Query: 118 VPFGLNAQQQYAWLYQGGGLAAIQKIY--ANFNVINFPAGSTGAQMGGWFKKEIKSVSDL 175 VPFG A + AWLY G G+ Q++Y A +NV P + GWF KEI S DL Sbjct: 83 VPFGPEAGEYMAWLYYGNGMDLYQEMYDQAGYNVHVLPCAILAPETSGWFAKEITSAEDL 142 Query: 176 KGLKMRIPGLGGQVMSRLGVNVQVLPGGEIYLALDRGAIDAAEWVGPYDDEKLGLNKAAQ 235 GLKMR GLGG+VM +LGV +LPGGEI+ AL++GAIDA E+ P D +LG +K + Sbjct: 143 NGLKMRFFGLGGKVMQKLGVATSLLPGGEIFPALEKGAIDATEFSMPAIDARLGFHKLVK 202 Query: 236 FYYYPGWWEPGPTLDVLVNLNAWNRLPKEYQEIFKTATVEANLTMLNQYDALNGEAL-TR 294 F Y+PGW + ++++N + WN ++++ I ++A + + +A+ AL Sbjct: 203 FNYFPGWHQQATVFELMINKDVWNDASEQHKAIIESACKASMADSFAEGEAIQHAALIDN 262 Query: 295 LLAGGTKLVPYSQEIMQAAQKISFDIFEENASKDAAFKQVYEQWKAFRKQIFAWNR 350 + G ++ +S E+++ + ++ E A+ D F +V FR W R Sbjct: 263 VEKNGVEMKQWSPEMLELFRATWDEVAAEEAANDEFFAKVLADMTTFRDGYALWKR 318 Lambda K H 0.317 0.132 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 325 Length adjustment: 29 Effective length of query: 335 Effective length of database: 296 Effective search space: 99160 Effective search space used: 99160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory