Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate 3607850 Dshi_1258 short-chain dehydrogenase/reductase SDR (RefSeq)
Query= metacyc::MONOMER-16230 (256 letters) >FitnessBrowser__Dino:3607850 Length = 247 Score = 134 bits (337), Expect = 2e-36 Identities = 86/242 (35%), Positives = 122/242 (50%), Gaps = 10/242 (4%) Query: 9 IVTGASRGIGRAAARECARQGARVVIGHSGSDEGRAGALSLAEEIAAFGGTAIAVGADAA 68 ++TG ++GIG A A A +GAR+++ S+ E A GG D Sbjct: 8 LITGGAQGIGYACAEALAAEGARIILADIQD--------SVQEAAARLGGAGYL--CDMG 57 Query: 69 DLDSGEKLVAAAVEAFGSVDVLVNNAGICPFHSFLDMPRELYLKTVGTNLNGAYFTVQAA 128 D + L G+V LVNNAGI FLD + + + NL G + Q A Sbjct: 58 DAAAVGALFDRIEAEHGAVTYLVNNAGIAAPGDFLDYDLATFDRVLDINLRGVFVATQRA 117 Query: 129 ARRMKEQGRGGAIIAVSSISALVGGAMQTHYTPTKAGLLSLMQSCAIALGPYGIRCNAVL 188 R M G GA++ +SSI+A V Y +K GL+ L + A+AL P+GIR NAV Sbjct: 118 GRSMVAHGIKGAVVNMSSINAQVAIPSIPAYCASKGGLMQLTKVAALALAPHGIRVNAVG 177 Query: 189 PGTIATDINKEDLSDLEKRERMTSRVPLGRLGEPDDLAGPIVFLASDMARYVTGASLLVD 248 PG+I T++ ++ E + SR PL R+G ++A + FL SD A YVTG ++ VD Sbjct: 178 PGSIDTEMMAGVNANPEAMNMVLSRTPLKRVGTAQEIANVVAFLCSDKASYVTGETIYVD 237 Query: 249 GG 250 GG Sbjct: 238 GG 239 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 247 Length adjustment: 24 Effective length of query: 232 Effective length of database: 223 Effective search space: 51736 Effective search space used: 51736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory