Align L-rhamnose-1-dehydrogenase ( EC 1.1.1.173) (characterized)
to candidate 3609684 Dshi_3067 acetoacetyl-CoA reductase (RefSeq)
Query= reanno::BFirm:BPHYT_RS28235 (260 letters) >FitnessBrowser__Dino:3609684 Length = 240 Score = 122 bits (306), Expect = 7e-33 Identities = 84/251 (33%), Positives = 128/251 (50%), Gaps = 15/251 (5%) Query: 6 KVVIVTGGSRGIGRAIAVACAAEGADVAINYWGDNDVSYGRRSAVAEVVAEIEALGRRVI 65 +V +VTGGSRGIG AI+ A+G VA Y G+++ + A EA G + Sbjct: 3 RVALVTGGSRGIGEAISKKLKADGYTVAATYAGNDE----------KAAAFTEATG--IK 50 Query: 66 AIEGNVAARETGQQLVRHTVEAFGKVDVLASNAGICPFHAFLDMPPEVLESTVAVNLNGA 125 + NVA E+ + + G ++V+ +NAGI F M PE + NL G Sbjct: 51 TYKWNVADYESSKAGIAQVEADLGPIEVVVANAGITRDAPFHKMTPEQWHEVIDTNLTGV 110 Query: 126 FYVTQAAAQQMKLQGTGGAIVATSSISALVGGGMQTHYTPTKAGVHSLMQSCAVALGPYG 185 F M+ + G I+ SSI+ G Q +Y TKAG +++S A G Sbjct: 111 FNTIHPVWPGMR-ERKFGRIIVISSINGQKGQFAQVNYAATKAGDLGIVKSLAQEGARAG 169 Query: 186 IRCNSVMPGTIATDLNAQDLADEAKKAYFEKRIPLGRLGRPEDVADCVTFLASDRARYVT 245 I N+V PG IAT++ + ++ +++ IP+GRLG PE++A CV FLASD A +++ Sbjct: 170 ITANAVCPGYIATEM-VMAIPEKVRESIIAG-IPVGRLGEPEEIARCVAFLASDDAGFIS 227 Query: 246 GAALLVDGGLF 256 G+ + +G F Sbjct: 228 GSTISANGAQF 238 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 240 Length adjustment: 24 Effective length of query: 236 Effective length of database: 216 Effective search space: 50976 Effective search space used: 50976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory