GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rhaP in Dinoroseobacter shibae DFL-12

Align RhaP, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate 3609043 Dshi_2432 Monosaccharide-transporting ATPase (RefSeq)

Query= TCDB::Q7BSH3
         (333 letters)



>lcl|FitnessBrowser__Dino:3609043 Dshi_2432
           Monosaccharide-transporting ATPase (RefSeq)
          Length = 327

 Score =  400 bits (1028), Expect = e-116
 Identities = 197/320 (61%), Positives = 249/320 (77%)

Query: 1   MARLIRKRETLLFLIIVVMIVVFSTRAADFATPGNLAGIFNDTSILIILALAQMTVILTK 60
           + RLI  RETLL   I++++ + ++R   F  P NLA +FNDTS LI+LA+ QM VILT+
Sbjct: 2   LKRLIASRETLLIAAILLLLALIASRFPAFIAPSNLAHVFNDTSPLILLAIGQMIVILTR 61

Query: 61  SIDLSVAANLAFTGMAIAMMNAAHPDLPLVVLILMAVVIGACLGAINGFLVWALEIPPIV 120
            IDLSVAANLA TGM ++M+N A P LP+VV++ +A+ +G  LG  NG LVW L+IPPIV
Sbjct: 62  CIDLSVAANLALTGMVVSMVNVAAPGLPIVVILAIAIGLGTLLGMFNGLLVWKLQIPPIV 121

Query: 121 VTLGTLTIYRGMAFVLSGGAWVNAHQMTPIFLSVPRTPVLGLPVLSWVGIIIVILMYVLL 180
           VTLGT+TI+RG+ F++S G WVN+H+M+P F + PR  +LGLPVLSW+ I+ VIL  +++
Sbjct: 122 VTLGTMTIFRGIIFLISDGKWVNSHEMSPAFKAFPRAELLGLPVLSWIAILAVILFTIVM 181

Query: 181 RYTQFGRSAYATGGNPTAAVYAGIDTGWTKFLAFVLSGALAGLASYLWVSRYAVAYVDIA 240
             T  GR+ YA GGNP AA YAGID G T+F AF +SGALAGL  YLWVSR+AV+YVDIA
Sbjct: 182 TRTTLGRAFYAAGGNPHAATYAGIDVGKTQFWAFTISGALAGLTGYLWVSRFAVSYVDIA 241

Query: 241 NGFELDSVAACVIGGISIAGGVGSVAGTVLGALFLGVIKNALPVIGISPFTQMAISGTVI 300
            GFELD VAACVIGG+SI GGVG+V G +LGALFLG+IKNALPV+ ISPF Q+AISG  I
Sbjct: 242 GGFELDVVAACVIGGVSIMGGVGTVGGALLGALFLGIIKNALPVVDISPFWQLAISGGAI 301

Query: 301 ILAVAFNARRERNRGRIILR 320
           I+AVA NA+  R +GRIIL+
Sbjct: 302 IIAVALNAQANRKKGRIILK 321


Lambda     K      H
   0.328    0.141    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 345
Number of extensions: 15
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 333
Length of database: 327
Length adjustment: 28
Effective length of query: 305
Effective length of database: 299
Effective search space:    91195
Effective search space used:    91195
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory