Align RhaQ (characterized, see rationale)
to candidate 3609042 Dshi_2431 Monosaccharide-transporting ATPase (RefSeq)
Query= uniprot:Q7BSH2 (337 letters) >FitnessBrowser__Dino:3609042 Length = 328 Score = 466 bits (1200), Expect = e-136 Identities = 242/315 (76%), Positives = 272/315 (86%), Gaps = 1/315 (0%) Query: 11 RIIPDRLGTPLRRIAASWEVLLFAVAVLIFVFNSLASPYFLDAWNLSDATFNFTEKAMIA 70 R+IPDRL +P+ + SWE LL VA+ IFV NS ASPYFL+AWNLSDATFNFTEKAMIA Sbjct: 6 RMIPDRLRSPMEQRLKSWETLLLLVAIGIFVANSFASPYFLNAWNLSDATFNFTEKAMIA 65 Query: 71 FAMALLVISGEIDLSVAAIIALASTAMGAAVQIGIGTPGLVLIGIGTGLACGVFNGVLVS 130 FAMALL+ISGEIDLSVA+IIALASTAMGAAVQ+G+GTPGLVLIG+G GL CG FNGVLV+ Sbjct: 66 FAMALLIISGEIDLSVASIIALASTAMGAAVQMGVGTPGLVLIGLGVGLLCGAFNGVLVT 125 Query: 131 VLKLPSIVVTIGTMSLFRGISYIVLGDQAYGKYPADFAYFGQGYVVWVFSFEFVLFIVLA 190 + LPSIVVTIGTMSLFRGISYIVLGDQA+ YP F++FGQGYV WV SFE VLF ++A Sbjct: 126 RMGLPSIVVTIGTMSLFRGISYIVLGDQAFRGYPESFSWFGQGYVWWVISFELVLFAIIA 185 Query: 191 VLFAILLHATNFGRQVYAIGNNDFAARFSGIPVERVKSILFLLTGIMSGIAAVCLTSRLG 250 V++A+LLH TNFGR VYAIGNN A FSGI V+RVK ILFLLTG+MSG+AA+CLT+RLG Sbjct: 186 VIYAMLLHKTNFGRAVYAIGNNATGAMFSGIRVQRVKFILFLLTGLMSGVAAICLTARLG 245 Query: 251 STRPSIAQGWELEVVTMVVLGGISILGGFRHDRGVFVIAAFVMGLVTFGLGLLNLPGIVM 310 STRPSIA GWELEVVTMVVLGG+SILGG GV VIAAFVMGLVTFGLGLLN+PGIVM Sbjct: 246 STRPSIAMGWELEVVTMVVLGGVSILGGSGTILGV-VIAAFVMGLVTFGLGLLNVPGIVM 304 Query: 311 SIFIGLLIIVTIAIP 325 SI IG L+I IA+P Sbjct: 305 SIVIGALLIGVIALP 319 Lambda K H 0.330 0.145 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 494 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 328 Length adjustment: 28 Effective length of query: 309 Effective length of database: 300 Effective search space: 92700 Effective search space used: 92700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory