Align RhaQ (characterized, see rationale)
to candidate 3609043 Dshi_2432 Monosaccharide-transporting ATPase (RefSeq)
Query= uniprot:Q7BSH2 (337 letters) >FitnessBrowser__Dino:3609043 Length = 327 Score = 146 bits (368), Expect = 8e-40 Identities = 97/319 (30%), Positives = 168/319 (52%), Gaps = 12/319 (3%) Query: 21 LRRIAASWEVLLFAVAVLIFVFNSLASPYFLDAWNLSDATFNFTEKAMIAFAMALLVISG 80 L+R+ AS E LL A +L+ + P F+ NL+ + + ++A +++++ Sbjct: 2 LKRLIASRETLLIAAILLLLALIASRFPAFIAPSNLAHVFNDTSPLILLAIGQMIVILTR 61 Query: 81 EIDLSVAAIIALASTAMGAAVQIGIGTPGLVL-----IGIGTGLACGVFNGVLVSVLKLP 135 IDLSVAA +AL + + + PGL + I IG G G+FNG+LV L++P Sbjct: 62 CIDLSVAANLALTGMVVS---MVNVAAPGLPIVVILAIAIGLGTLLGMFNGLLVWKLQIP 118 Query: 136 SIVVTIGTMSLFRGISYIVLGDQAYGKYPADFAY--FGQGYVVWVFSFEFVLFIVLAVLF 193 IVVT+GTM++FRGI +++ + + A+ F + ++ + ++ I+ +LF Sbjct: 119 PIVVTLGTMTIFRGIIFLISDGKWVNSHEMSPAFKAFPRAELLGLPVLSWIA-ILAVILF 177 Query: 194 AILLHATNFGRQVYAIGNNDFAARFSGIPVERVKSILFLLTGIMSGIAAVCLTSRLGSTR 253 I++ T GR YA G N AA ++GI V + + F ++G ++G+ SR + Sbjct: 178 TIVMTRTTLGRAFYAAGGNPHAATYAGIDVGKTQFWAFTISGALAGLTGYLWVSRFAVSY 237 Query: 254 PSIAQGWELEVVTMVVLGGISILGGFRHDRGVFVIAAFVMGLVTFGLGLLNLPGIVMSIF 313 IA G+EL+VV V+GG+SI+GG G ++ A +G++ L ++++ Sbjct: 238 VDIAGGFELDVVAACVIGGVSIMGGVGTVGGA-LLGALFLGIIKNALPVVDISPFWQLAI 296 Query: 314 IGLLIIVTIAIPIIARRIK 332 G II+ +A+ A R K Sbjct: 297 SGGAIIIAVALNAQANRKK 315 Lambda K H 0.330 0.145 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 327 Length adjustment: 28 Effective length of query: 309 Effective length of database: 299 Effective search space: 92391 Effective search space used: 92391 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory