Align ABC transporter permease (characterized, see rationale)
to candidate 3607107 Dshi_0529 Monosaccharide-transporting ATPase (RefSeq)
Query= uniprot:A0A166R405 (325 letters) >FitnessBrowser__Dino:3607107 Length = 333 Score = 129 bits (325), Expect = 8e-35 Identities = 94/314 (29%), Positives = 153/314 (48%), Gaps = 15/314 (4%) Query: 23 LAGALLAMVALFSVLSSHFLSYDTFSTLANQIPDLMVLAVGMTFVLIIGGIDLSVGSVLA 82 +AG ++ + +V FL+ T S L + +LAVG VL+ GGID+S ++ Sbjct: 17 VAGVIMLFCFVATVSDPRFLTITTVSDLLRASIVIGILAVGAMLVLVSGGIDVSFTAIAV 76 Query: 83 LAASAVSVAILGWGWSVLP---AALLGMAVAALAGTITGSITVAWRIPSFIVSLGVLEMA 139 A + +V L W +P ++ + A G I G +P+ IV+LG L + Sbjct: 77 FAMYSSTVLSLTI-WPEIPWPVIFVISVVFGAALGAINGFFIAFLGLPTLIVTLGTLSIF 135 Query: 140 RGLAYQMTGS-RTAYIGDAFAWLSNPIA----------FGISPSFIIALLIIFIAQAVLT 188 RG GS R + + + S + + I + + L +I + +L Sbjct: 136 RGFLLTFIGSQRISDLPPSMRDFSRGVIARGTTEAGNFYSIPWAALALLFVIVLTWFILK 195 Query: 189 RTVFGRYLIGIGTNEEAVRLAGINPKPYKILVFSLMGLLAGIAALFQISRLEAADPNAGS 248 +T+ GR + IG + E+ R GIN K + V+ +G LAG+A + S ADP + Sbjct: 196 KTMLGRSIYAIGGSVESARRIGINVKWTQFFVYVYVGALAGLAGIIHGSVGRMADPFSLV 255 Query: 249 GLELQVIAAVVIGGTSLMGGRGSVISTFFGVLIISVLAAGLAQIGATEPTKRIITGAVIV 308 GLEL VIAAVV+GG L+GG G++ T GV +I ++ L IG + + G +I+ Sbjct: 256 GLELSVIAAVVLGGARLIGGYGTLTGTMLGVALIVIVQNSLIVIGIPTTWQSVTIGILIL 315 Query: 309 VAVVLDTYRSQRAS 322 + + YR++RA+ Sbjct: 316 LGTGVPAYRAKRAA 329 Lambda K H 0.325 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 333 Length adjustment: 28 Effective length of query: 297 Effective length of database: 305 Effective search space: 90585 Effective search space used: 90585 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory