Align L-serine dehydratase, alpha chain; Short=SDH; EC 4.3.1.17 (characterized, see rationale)
to candidate 3608720 Dshi_5008 L-serine dehydratase (NCBI)
Query= uniprot:P33073 (292 letters) >FitnessBrowser__Dino:3608720 Length = 470 Score = 136 bits (343), Expect = 8e-37 Identities = 92/253 (36%), Positives = 137/253 (54%), Gaps = 23/253 (9%) Query: 38 IRKKLDAVIDVMHASATKNLTQSDVTEYKM-IDGFAKRTYEY--ANSGKS-----IVGDF 89 + K++DAV VM A + L + + + AK +E A G++ + D+ Sbjct: 220 LNKRIDAVCAVMDACIDRGLRMDGILPGGLKVKRRAKAIHEQLLAERGQNQSQPHVANDW 279 Query: 90 LAKAMAMAFSTSEVNASMGKIVAAPTAGSSGIMPAMLVAATEKYNFDRTT------IQNG 143 L+ A + +E NA+ G++V +PT G++G++PA++ +Y D ++ Sbjct: 280 LS---VYAMAVNEENAAGGRVVTSPTNGAAGVVPAVI-----RYYRDHCIGATAEGVRTF 331 Query: 144 FLTSIGIGQVITKYATFAGAEGGCQAECGSASAMAAAALVEMLGGTVEQALHAASITIIN 203 LT+ IG +I A+ +GAE GCQ E GSASAMAAA +GGT Q +AA I + + Sbjct: 332 MLTASAIGGLIKHNASISGAEMGCQGEVGSASAMAAAGFCAAMGGTNAQIENAAEIALEH 391 Query: 204 VLGLVCDPIAGLVQYPCTFRNASGVINAFISADLALAGVES-LVPFDEVVIAMGEVGNSM 262 LG+ CDP AGLVQ PC RN G I A +A LAL G + +P D + M + G+ M Sbjct: 392 HLGMTCDPAAGLVQVPCIERNGLGAIKAVSAASLALRGDGTHFMPLDNCIETMRQTGHDM 451 Query: 263 IEALRETGLGGLA 275 + +ET LGGLA Sbjct: 452 LTKYKETSLGGLA 464 Lambda K H 0.317 0.132 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 470 Length adjustment: 30 Effective length of query: 262 Effective length of database: 440 Effective search space: 115280 Effective search space used: 115280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory