Align SmoF, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate 3609760 Dshi_3143 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= TCDB::O30832 (290 letters) >FitnessBrowser__Dino:3609760 Length = 290 Score = 134 bits (336), Expect = 3e-36 Identities = 86/260 (33%), Positives = 145/260 (55%), Gaps = 9/260 (3%) Query: 8 TAARLMISPAVILLFLWMIVPLSMTLYFSFLRYNLLMPG-MESFTGWDNYYY-FLTDPAF 65 T ++ PAV+++F I PL SF L PG +E + GW+NY + F +PAF Sbjct: 5 TLKYFLVLPAVVVVFATAIWPLIEAARMSFTVGRLNRPGSLEQYIGWENYAWAFFEEPAF 64 Query: 66 SAALTNTILLVVGVLLITVVGGVLLALLLDQPFWGQGIVRVLVIAPFFVMPTVSALVWKN 125 ++ T L V + +T + + LALLL + + L+I PF + P + + ++ Sbjct: 65 WNSVYVTALYTVVTVGLTTLLALGLALLLAPGGRLRVSAQTLLILPFAMSPALIGVSFRF 124 Query: 126 MFMNPVNGMFAHIARGLGLPPF---DFLSQAPLASIIGIVA--WQWLPFATLILLTALQS 180 MF NP G+F G+ +PP +L+ LA + ++A W W+PF TL+L+ L S Sbjct: 125 MF-NPEFGLFDAFF-GVMIPPLADVSWLADPTLAFAVVVMADVWGWIPFLTLVLIGGLAS 182 Query: 181 LDREQMEAAEMDGASALDRFIHITVPHLTRAITVVVLIQTIFLLGVFAEILVTTNGGPGT 240 + R+ +EAA++DGAS+ F +T+P L + VV+++++IF L F ++ + TNGGPGT Sbjct: 183 VPRDTIEAAQVDGASSWRVFRDVTLPQLGPVLAVVIILKSIFSLKTFDQVFMLTNGGPGT 242 Query: 241 ASTNITYLVYAQSLLNYDVG 260 A+ +++ +Y + +G Sbjct: 243 ATQTLSHYIYFNGMKYGQIG 262 Lambda K H 0.329 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 290 Length adjustment: 26 Effective length of query: 264 Effective length of database: 264 Effective search space: 69696 Effective search space used: 69696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory