Align MtlG, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized)
to candidate 3608007 Dshi_1415 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= TCDB::O30493 (276 letters) >FitnessBrowser__Dino:3608007 Length = 294 Score = 107 bits (268), Expect = 2e-28 Identities = 86/293 (29%), Positives = 142/293 (48%), Gaps = 34/293 (11%) Query: 10 QSLLLGTLAWAIAILIF----FPIFWMVLTSFKTEIDAFATPPQFIFTPTLENYLHINER 65 +S+ L W + +L FP W + SFK + D F+ +T L + E Sbjct: 9 RSMPLRLFLWGVVLLWLMLAAFPFLWTLWGSFKVQGDFFSRED---WTNALTGVRTLAET 65 Query: 66 SNYFSY-----AW----------NSVLISFSATALCLLISVPAAYSMAFYETKRTKSTLL 110 YF+ AW N+++++ S A+ L Y+++ K T L+ Sbjct: 66 GGYFTGGGYAGAWVQEEFWRAGLNTMIVTLSVVAISLTFGTLGGYALSRSSFKYTFWILM 125 Query: 111 WMLSTKMLPPV----GVLMPIYLLAKSFGLLDTRIALIIIYTLINLPIVVWMVYTYFKDI 166 L + +P + G L+P + L +G+L T I I+ IN P +WM+ ++F +I Sbjct: 126 AALIFRAMPHITLVSGYLLPFFEL-NIWGILPTTI---IVLVAINQPFTLWMLRSFFMNI 181 Query: 167 PKDILEAARLDGATLWQEMVRVLLPIAKGGLASTVLLSLILCWNEAFWSLNLTSSNAAPL 226 PKD+ E+A +DG T +Q RV++P+ G+ +T L S +L +N+ + L S + + Sbjct: 182 PKDLDESAMVDGCTRFQAFRRVIIPVMWPGVITTGLFSFLLAYNDFAVTATLLSQDNQTM 241 Query: 227 TALIASY---SSPEGLFWAKLSAVSTLACAPILIFGWISQKQLVRGLSFGAVK 276 IAS+ + EG +SAV + A AP+ I Q+Q+V GL+ GAVK Sbjct: 242 IPKIASFLGTTQQEGNVMFAVSAVVS-ATAPLFILVLFFQRQIVSGLTAGAVK 293 Lambda K H 0.327 0.137 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 294 Length adjustment: 26 Effective length of query: 250 Effective length of database: 268 Effective search space: 67000 Effective search space used: 67000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory