Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate 3608790 Dshi_2182 3-oxoacyl-(acyl-carrier-protein) reductase (RefSeq)
Query= BRENDA::Q1J2J0 (255 letters) >FitnessBrowser__Dino:3608790 Length = 245 Score = 156 bits (394), Expect = 4e-43 Identities = 104/245 (42%), Positives = 141/245 (57%), Gaps = 10/245 (4%) Query: 13 LFRLDGRHALVTGGAQGIGFEIARGLAQAGARVTIADLNPDVGEGAARELDGTFERL--N 70 +F L G+ ALVTG + GIG IA L GA V ++ D E A EL L N Sbjct: 1 MFDLTGKTALVTGASGGIGGAIATALHAQGATVGLSGTRVDPLEALAAELGERAHVLPCN 60 Query: 71 VTDADAVADLARR----LPDVDVLVNNAGIVRNAPAEDTPDDDWRAVLSVNLDGVFWCCR 126 ++DADAV L ++ + VD+LVNNAGI R+ D++W +VL VNL CR Sbjct: 61 LSDADAVEALPKQAVAAMGSVDILVNNAGITRDNLFMRMSDEEWASVLDVNLTSTMRLCR 120 Query: 127 EFGRTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASRGVRVN 186 R M+ G IV+ +S+ G N Q Y ASKA ++ +++SLA E ASRG+ VN Sbjct: 121 GVLRGMMKARWGRIVNISSVVGATGN--PGQGNYAASKAGMVGMSKSLAYEVASRGITVN 178 Query: 187 AVAPGYTATPLTRRGLETPEWRETWLKETPLGRLAEPREIAPAVLYLASDAASFVTGHTL 246 AVAPG+ +T +T + T + ++ L + P GR+ EP EIA AV+YLAS A +VTG L Sbjct: 179 AVAPGFISTAMTDK--LTDDQKDKLLVQVPSGRMGEPGEIAAAVVYLASPEAGYVTGSVL 236 Query: 247 VVDGG 251 V+GG Sbjct: 237 HVNGG 241 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 245 Length adjustment: 24 Effective length of query: 231 Effective length of database: 221 Effective search space: 51051 Effective search space used: 51051 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory