Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate 3607850 Dshi_1258 short-chain dehydrogenase/reductase SDR (RefSeq)
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >FitnessBrowser__Dino:3607850 Length = 247 Score = 109 bits (273), Expect = 5e-29 Identities = 83/254 (32%), Positives = 125/254 (49%), Gaps = 25/254 (9%) Query: 14 VTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQSS--GNYNFWPTDISSASEVHKTVD 71 +TGGA GIG A + L A+GA + + DI + ++ G + D+ A+ V D Sbjct: 9 ITGGAQGIGYACAEALAAEGARIILADIQDSVQEAAARLGGAGYL-CDMGDAAAVGALFD 67 Query: 72 HIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVNINQKGVFLMSQAVA 131 I G + LVNNAG+ P +D Y+L A F+++++IN +GVF+ +Q Sbjct: 68 RIEAEHGAVTYLVNNAGIAAPGDFLD-------YDL--ATFDRVLDINLRGVFVATQRAG 118 Query: 132 RQMVKQR-SGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKELGKHGIRVVGVAP 190 R MV G +VN+SS + Y A+K L T+ + L HGIRV V P Sbjct: 119 RSMVAHGIKGAVVNMSSINAQVAIPSIPAYCASKGGLMQLTKVAALALAPHGIRVNAVGP 178 Query: 191 GILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGRSGRLTEVADFVCYLLSERA 250 G ++ E +A N E + S+ PL R G E+A+ V +L S++A Sbjct: 179 GSIDT---------EMMAGV-NANPEAMNMVLSRT--PLKRVGTAQEIANVVAFLCSDKA 226 Query: 251 SYMTGVTTNIAGGK 264 SY+TG T + GG+ Sbjct: 227 SYVTGETIYVDGGR 240 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 247 Length adjustment: 24 Effective length of query: 243 Effective length of database: 223 Effective search space: 54189 Effective search space used: 54189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory