Align sorbitol-6-phosphate dehydrogenase (characterized)
to candidate 3608139 Dshi_1544 3-hydroxybutyrate dehydrogenase (RefSeq)
Query= CharProtDB::CH_091826 (259 letters) >FitnessBrowser__Dino:3608139 Length = 257 Score = 101 bits (252), Expect = 1e-26 Identities = 76/255 (29%), Positives = 128/255 (50%), Gaps = 9/255 (3%) Query: 3 QVAVVIGGGQTLGAFLCEGLAQAGYHVAVADLNESNANR-LADTINSRYGAGRAYGFKVD 61 + AV+ G +G + LA+AG V + + + LAD I G Y K D Sbjct: 6 KTAVITGSNSGIGLGIAWELARAGADVVLNSFTDREEDHALADEIARETGVYARY-IKAD 64 Query: 62 ATDEASVEALARAVDETFGRADLLVYSAGVAKAAPITQFRLTDFDLSLQVNLVGYFLCSR 121 + RA+ E+ G D+LV +AG+ API +F + +D + +N+ F + Sbjct: 65 MSKGDD----CRALIESAGTCDILVNNAGIQHVAPIDEFPVDKWDAIIAINMNSAFHTTA 120 Query: 122 EFSKLMIRDGIKGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVHS 181 +M + G GR++ I S G S + + Y AAK G VG+T+++AL+ A+ IT ++ Sbjct: 121 AALPMMRKAGW-GRVVNIASAHGLTASPYKAAYVAAKHGVVGMTKTVALETAQEPITCNA 179 Query: 182 LMLGNLLKSPMFQSLLPQYAEKLGITPEEV-EPYYVDKVPLKRGCDYQDVLNVLLFYASD 240 + G +L +P+ ++ +P EK + EEV + +++ P K + + +F SD Sbjct: 180 ICPGYVL-TPLVEAQIPNTMEKYDMGREEVIKQVMLERQPSKEFATVEQLGGTCVFLCSD 238 Query: 241 KAAYCTGQSINVTGG 255 AA TG +I+V GG Sbjct: 239 AAAQITGTTISVDGG 253 Lambda K H 0.319 0.136 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 257 Length adjustment: 24 Effective length of query: 235 Effective length of database: 233 Effective search space: 54755 Effective search space used: 54755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory