GapMind for catabolism of small carbon sources

 

Aligments for a candidate for frcA in Dinoroseobacter shibae DFL-12

Align ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale)
to candidate 3609044 Dshi_2433 ABC transporter related (RefSeq)

Query= uniprot:A0A0C4Y5F6
         (540 letters)



>lcl|FitnessBrowser__Dino:3609044 Dshi_2433 ABC transporter related
           (RefSeq)
          Length = 510

 Score =  365 bits (938), Expect = e-105
 Identities = 221/505 (43%), Positives = 300/505 (59%), Gaps = 14/505 (2%)

Query: 6   DTSTKAPLLALRNICKTFPGVRALRKVELTAYAGEVHALMGENGAGKSTLMKILSGAYTA 65
           D       LAL +I KTFPGV+AL  V L+ Y G+V AL+GENGAGKST++KIL+G Y  
Sbjct: 13  DPPVSQAALALAHITKTFPGVKALSDVSLSLYPGKVTALIGENGAGKSTVVKILTGIYQP 72

Query: 66  DPGGECHIDGQRVQIDGPQSARDLGVAVIYQELSLAPNLSVAENIYLGRALQRR-GLVAR 124
           D GG   +DGQ V    PQ+A D GV  I+QE  L   LSVAENI+LG A +   GL+  
Sbjct: 73  D-GGRILVDGQPVPFSTPQAAADHGVTAIHQETVLFDELSVAENIFLGHAPRGAFGLIDW 131

Query: 125 GDMVRACAPTLARLGADFSPAANVASLSIAQRQLVEIARAVHFEARILVMDEPTTPLSTH 184
                     L  +GA+  P   +  L IA + LV IARA+  EAR+++MDEPT  LS  
Sbjct: 132 KKTTENARALLTSIGAELDPDHKLKDLGIANKHLVAIARALSIEARVVIMDEPTAALSHK 191

Query: 185 ETDRLFALIRQLRGEGMAILYISHRMAEIDELADRVTVLRDGCFVGTLDRAHLSQAALVK 244
           E + L+ L+  L+ +G AIL+ISH+  EI  +AD  TV RDG  +G    A +++A LVK
Sbjct: 192 EIEELYELVESLKAQGKAILFISHKFDEIFRIADNYTVFRDGQLIGDGAIADVTEADLVK 251

Query: 245 MMVGRDLSGFYTKTHGQAVEREVMLSVRDVADGRRVKGCSFDLRAGEVLGLAGLVGAGRT 304
           MMVGRD+S  + +        + +L+V+  A        SF LR GE+LG  GLVGAGR+
Sbjct: 252 MMVGRDVSQIFPQRAPNV--GDTVLTVQGYAHPTEFDDISFTLREGEILGFYGLVGAGRS 309

Query: 305 ELARLVFGADARTRGEVRIANPAGSGGLVTLPAGGPRQAIDAGIAYLTEDRKLQGLFLDQ 364
           E  + +FG    + G V I    G+   ++ PA     A+D GI Y+ EDR  QG  LD 
Sbjct: 310 EFMQSLFGITRPSAGSVEIG---GARAEISSPA----DAVDHGIVYVPEDRGKQGAILDL 362

Query: 365 SVHENINLIVAAR-DALGLGRLNRTAARRRTTEAIDTLGIRVAHAQVNVGALSGGNQQKV 423
            + +N+ L    R    G  RL    A  R  E  + L +R A    +VG LSGGNQQKV
Sbjct: 363 PIFQNVTLPSLGRISRKGFLRLAEEFALAR--EYTERLDLRAASLDTHVGNLSGGNQQKV 420

Query: 424 MLSRLLEIQPRVLILDEPTRGVDIGAKSEIYRLINALAQSGVAILMISSELPEVVGLCDR 483
           ++++ L  +PRV+ILDEPT+GVDIG+K+ ++  +  LA  G+A++M+SSE+PEV+G+ DR
Sbjct: 421 VIAKWLATRPRVIILDEPTKGVDIGSKAAVHDFMAELAAQGLAVIMVSSEIPEVLGMSDR 480

Query: 484 VLVMREGTLAGEVRPAGSAAETQER 508
           V+VMREG +  E+       ET  R
Sbjct: 481 VIVMREGRIVAELAGDDLQPETLVR 505



 Score = 75.5 bits (184), Expect = 5e-18
 Identities = 61/226 (26%), Positives = 104/226 (46%), Gaps = 13/226 (5%)

Query: 32  VELTAYAGEVHALMGENGAGKSTLMKILSGAYTADPGGECHIDGQRVQIDGPQSARDLGV 91
           +  T   GE+    G  GAG+S  M+ L G  T    G   I G R +I  P  A D G+
Sbjct: 288 ISFTLREGEILGFYGLVGAGRSEFMQSLFGI-TRPSAGSVEIGGARAEISSPADAVDHGI 346

Query: 92  AVIYQELSLAP---NLSVAENIYL---GRALQRRGLVARGDMVRACAPTLARLGADFSPA 145
             + ++        +L + +N+ L   GR + R+G +   +          RL  D   A
Sbjct: 347 VYVPEDRGKQGAILDLPIFQNVTLPSLGR-ISRKGFLRLAEEFALAREYTERL--DLRAA 403

Query: 146 A---NVASLSIAQRQLVEIARAVHFEARILVMDEPTTPLSTHETDRLFALIRQLRGEGMA 202
           +   +V +LS   +Q V IA+ +    R++++DEPT  +       +   + +L  +G+A
Sbjct: 404 SLDTHVGNLSGGNQQKVVIAKWLATRPRVIILDEPTKGVDIGSKAAVHDFMAELAAQGLA 463

Query: 203 ILYISHRMAEIDELADRVTVLRDGCFVGTLDRAHLSQAALVKMMVG 248
           ++ +S  + E+  ++DRV V+R+G  V  L    L    LV+   G
Sbjct: 464 VIMVSSEIPEVLGMSDRVIVMREGRIVAELAGDDLQPETLVRHAAG 509


Lambda     K      H
   0.320    0.136    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 632
Number of extensions: 26
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 540
Length of database: 510
Length adjustment: 35
Effective length of query: 505
Effective length of database: 475
Effective search space:   239875
Effective search space used:   239875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory