Align Ribose ABC transport system, permease protein RbsC (characterized, see rationale)
to candidate 3609043 Dshi_2432 Monosaccharide-transporting ATPase (RefSeq)
Query= uniprot:A0A0C4Y7K0 (337 letters) >FitnessBrowser__Dino:3609043 Length = 327 Score = 174 bits (442), Expect = 2e-48 Identities = 113/316 (35%), Positives = 179/316 (56%), Gaps = 11/316 (3%) Query: 24 LTTQERLRALGMLPVLVLLCIGFSVLTENFAGWQNLSIIAQQASINMVLAAGMTFVILTG 83 + ++E L +L +L L+ F F NL+ + S ++LA G VILT Sbjct: 6 IASRETLLIAAILLLLALIASRFPA----FIAPSNLAHVFNDTSPLILLAIGQMIVILTR 61 Query: 84 GIDLSVGSILSISAVVAMLVSLM-PQLGMLSVPA-ALLCGLLFGIVNGALVAFMKLPPFI 141 IDLSV + L+++ +V +V++ P L ++ + A A+ G L G+ NG LV +++PP + Sbjct: 62 CIDLSVAANLALTGMVVSMVNVAAPGLPIVVILAIAIGLGTLLGMFNGLLVWKLQIPPIV 121 Query: 142 VTLGTLTAVRGLARLVGNDSTIYNPDIGFAF--IGNGEVLGVPWLVIIAFAVVAVSWFVL 199 VTLGT+T RG+ L+ + + + ++ AF E+LG+P L IA V + V+ Sbjct: 122 VTLGTMTIFRGIIFLISDGKWVNSHEMSPAFKAFPRAELLGLPVLSWIAILAVILFTIVM 181 Query: 200 RRTVLGLQIYAVGGNAEAARLSGIKVWVVLLFVYAVSGLLAGLGGVMSSARLYAANGLQL 259 RT LG YA GGN AA +GI V + + +SG LAGL G + +R +A + + + Sbjct: 182 TRTTLGRAFYAAGGNPHAATYAGIDVGKTQFWAFTISGALAGLTGYLWVSR-FAVSYVDI 240 Query: 260 GQSYELDAIAAVILGGTSFVGGTGSIVGTLVGALIIAVLSNGLVLLGVSDIWQYIIKGLV 319 +ELD +AA ++GG S +GG G++ G L+GAL + ++ N L ++ +S WQ I G Sbjct: 241 AGGFELDVVAACVIGGVSIMGGVGTVGGALLGALFLGIIKNALPVVDISPFWQLAISGGA 300 Query: 320 IIGAVALDSY--RRKG 333 II AVAL++ R+KG Sbjct: 301 IIIAVALNAQANRKKG 316 Lambda K H 0.325 0.141 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 327 Length adjustment: 28 Effective length of query: 309 Effective length of database: 299 Effective search space: 92391 Effective search space used: 92391 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory