Align UTP--glucose-1-phosphate uridylyltransferase; Alpha-D-glucosyl-1-phosphate uridylyltransferase; General stress protein 33; GSP33; UDP-glucose pyrophosphorylase; UDPGP; Uridine diphosphoglucose pyrophosphorylase; EC 2.7.7.9 (characterized)
to candidate 3610196 Dshi_3577 UTP-glucose-1-phosphate uridylyltransferase (RefSeq)
Query= SwissProt::Q05852 (292 letters) >FitnessBrowser__Dino:3610196 Length = 298 Score = 285 bits (730), Expect = 7e-82 Identities = 136/287 (47%), Positives = 201/287 (70%), Gaps = 2/287 (0%) Query: 2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKSK 61 + V+ A+ P AG+GTRFLPATK++PKE++ +VD+P +QY I+EA AGIE+ I VT + K Sbjct: 4 RSVKTAVFPVAGMGTRFLPATKSVPKEIMTLVDRPLVQYAIDEARAAGIEEFIFVTSRGK 63 Query: 62 RAIEDHFDYSPELERNLEEKGKTELLEKVKKAS-NLADIHYIRQKEPKGLGHAVWCARNF 120 A+ED+FD +P+LE+ LE+KGKT+LLE ++ + + I Y+RQ GLGHAVWCAR Sbjct: 64 SALEDYFDAAPQLEQTLEDKGKTKLLEILRNTNMDSGAIAYVRQTRALGLGHAVWCARRL 123 Query: 121 IGDEPFAVLLGDDIVQAETPGLRQLMDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTSEG 180 +G+EPFAV+L DD++ AE P L Q+++ Y++ +++ +VP ++ YGI+D G Sbjct: 124 LGNEPFAVILPDDVIAAEKPCLAQMVEAYQELGGNMVATMEVPMDKASAYGIVDVEEDMG 183 Query: 181 RRYQVKNFVEKPPKGTAPSNLAILGRYVFTPEIFMYLEEQQVGAGGEIQLTDAI-QKLNE 239 +VK +EKP APSNLA++GRY+ +PE+ L++ Q+GAGGEIQLTDAI Q++ Sbjct: 184 SVVRVKGMIEKPKAEDAPSNLAVIGRYILSPEVLDNLDKGQIGAGGEIQLTDAIAQEITS 243 Query: 240 IQRVFAYDFEGKRYDVGEKLGFITTTLEFAMQDKELRDQLVPFMEGL 286 V+ + F G+RYD G K GF+ T+ FA+ +LRD+L F++ L Sbjct: 244 KNNVYGFRFSGQRYDCGSKAGFLQATVSFALARPDLRDELSDFLQEL 290 Lambda K H 0.317 0.138 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 298 Length adjustment: 26 Effective length of query: 266 Effective length of database: 272 Effective search space: 72352 Effective search space used: 72352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate 3610196 Dshi_3577 (UTP-glucose-1-phosphate uridylyltransferase (RefSeq))
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01099.hmm # target sequence database: /tmp/gapView.1974.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01099 [M=261] Accession: TIGR01099 Description: galU: UTP--glucose-1-phosphate uridylyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-105 338.0 0.0 2.4e-105 337.8 0.0 1.0 1 lcl|FitnessBrowser__Dino:3610196 Dshi_3577 UTP-glucose-1-phosphat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3610196 Dshi_3577 UTP-glucose-1-phosphate uridylyltransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 337.8 0.0 2.4e-105 2.4e-105 1 261 [] 6 268 .. 6 268 .. 0.97 Alignments for each domain: == domain 1 score: 337.8 bits; conditional E-value: 2.4e-105 TIGR01099 1 irkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraiedhfDtsyeleaklek 77 +++av+P+aG+Gtr+LPatk++Pke++++vd+Pl+qy+++ea +aGiee ++vt+r+k a+ed+fD + +le++le+ lcl|FitnessBrowser__Dino:3610196 6 VKTAVFPVAGMGTRFLPATKSVPKEIMTLVDRPLVQYAIDEARAAGIEEFIFVTSRGKSALEDYFDAAPQLEQTLED 82 689************************************************************************** PP TIGR01099 78 knkeellkevrkiael.atilyvrqkeakGLGhavllaeelvgdepfavllgDdlvseeeealkqlielyektgasi 153 k+k++ll+ +r+ i yvrq +a GLGhav++a++l+g+epfav+l+Dd++++e+++l+q++e+y++ g ++ lcl|FitnessBrowser__Dino:3610196 83 KGKTKLLEILRNTNMDsGAIAYVRQTRALGLGHAVWCARRLLGNEPFAVILPDDVIAAEKPCLAQMVEAYQELGGNM 159 ***********9865449*********************************************************** PP TIGR01099 154 iaveevpkeevskYGvidgeeveeelyevkdlvekPkpeeapsnlaivGrYvltpeifelleetkaGkggeiqltDa 230 +a +evp ++ s+YG++d+ee ++++vk ++ekPk+e+apsnla++GrY+l+pe+ + l++ ++G+ggeiqltDa lcl|FitnessBrowser__Dino:3610196 160 VATMEVPMDKASAYGIVDVEEDMGSVVRVKGMIEKPKAEDAPSNLAVIGRYILSPEVLDNLDKGQIGAGGEIQLTDA 236 ***************************************************************************** PP TIGR01099 231 lrl.llekeevlavklkgkryDvGdklgylka 261 +++ +++k++v++++++g+ryD+G+k g+l+a lcl|FitnessBrowser__Dino:3610196 237 IAQeITSKNNVYGFRFSGQRYDCGSKAGFLQA 268 *861557889********************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (298 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 8.54 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory