Align glucose transporter, periplasmic substrate-binding component (characterized)
to candidate 3608607 Dshi_2000 D-xylose ABC transporter, periplasmic substrate-binding protein (RefSeq)
Query= reanno::Phaeo:GFF3639 (341 letters) >FitnessBrowser__Dino:3608607 Length = 340 Score = 561 bits (1445), Expect = e-164 Identities = 284/334 (85%), Positives = 301/334 (90%), Gaps = 1/334 (0%) Query: 8 SALAFAATASMAFAEDVTVGVSWSNFQEERWKTDEAAIKAALEAKGATYVSADAQSSSAK 67 +A+ A + A+A DVTVGVSWSNFQEERWKTDEAAIKAALEA GATYVSADAQSSSAK Sbjct: 8 AAIVAAGVTTSAYA-DVTVGVSWSNFQEERWKTDEAAIKAALEAAGATYVSADAQSSSAK 66 Query: 68 QLSDIESLIAQGVDALIVLAQDAQAIGPAVQAAADEGIPVVAYDRLIEDGRAFYLTFDNV 127 QLSD+ESLIAQGVDALI+LAQD+QAIGPAVQAAADEGIPVV YDRLIED RAFYLTFDNV Sbjct: 67 QLSDVESLIAQGVDALIILAQDSQAIGPAVQAAADEGIPVVGYDRLIEDPRAFYLTFDNV 126 Query: 128 EVGRMQARAVLEAQPSGNYVMIKGSPTDPNADFLRGGQQEIIQAAIDSGDIKIVGEAYTD 187 EVGRMQARAVLE P GNYVMIKGSPTDPNADFLRGGQQEI+Q AID+G I IVGEAYTD Sbjct: 127 EVGRMQARAVLEQAPEGNYVMIKGSPTDPNADFLRGGQQEILQDAIDAGKITIVGEAYTD 186 Query: 188 GWLPANAQRNMEQILTANDNKVDAVVASNDGTAGGVVAALTAQGMEGIAVSGQDGDHAAL 247 GWLPANAQRNMEQILTA DN+VDAVVASNDGTAGGVVAALTAQGMEGI VSGQDGDHAAL Sbjct: 187 GWLPANAQRNMEQILTAQDNQVDAVVASNDGTAGGVVAALTAQGMEGIPVSGQDGDHAAL 246 Query: 248 NRVAKGTQTVSVWKDARDLGKAAANIAVEMAEGAVMGDVAGGAAWTSPAGTELTARFLEP 307 NRVAKGTQTVSVWKDARDLG+AA IAV MA G M D+ G +WTSP GTELTARFL P Sbjct: 247 NRVAKGTQTVSVWKDARDLGRAAGEIAVAMANGTAMADIEGATSWTSPGGTELTARFLAP 306 Query: 308 IPVTADNLSVVVDAGWITKEALCQGVTNGPAPCN 341 +PVTADNL+ VVDA WIT+E LCQGVT+GPAPCN Sbjct: 307 VPVTADNLTAVVDAQWITQETLCQGVTDGPAPCN 340 Lambda K H 0.313 0.128 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 340 Length adjustment: 28 Effective length of query: 313 Effective length of database: 312 Effective search space: 97656 Effective search space used: 97656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory