Align Aminomethyltransferase (EC 2.1.2.10) (characterized)
to candidate 3609296 Dshi_2682 glycine cleavage system T protein (RefSeq)
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1866 (374 letters) >FitnessBrowser__Dino:3609296 Length = 361 Score = 338 bits (866), Expect = 2e-97 Identities = 189/368 (51%), Positives = 241/368 (65%), Gaps = 8/368 (2%) Query: 6 LLKTPLHALHIELGARMVPFAGYDMPVQYPLGVMKEHQHTRDQAGLFDVSHMGQIRLTGA 65 L KTPLH LH+ELGA+MVPFA ++MPVQYP G+M EH R+ A LFDVSHM Q+ +TG Sbjct: 2 LKKTPLHPLHLELGAKMVPFAWWEMPVQYPTGIMAEHAACREGAALFDVSHMCQMEITGD 61 Query: 66 NAAKALETLVPVDIIDLPVGMQRYAMFTNATGGILDDLMVANLGNDELFLVVNAACKDQD 125 + A ALE LVP I L G RY T GGI DDL+V L++V NA+ DQD Sbjct: 62 DPAAALERLVPGGITSLAPGQARYTQLTTGAGGIYDDLIVTR-DPGGLYVVANASMADQD 120 Query: 126 LAHLRKHIGDQCTIEPLFEERALLALQGPAAVTVLARLAPEVAKMTFMQFARVKLLGVDC 185 + LR + D CT+ + E+ AL+A+QGPAA ++A L P + FMQ A+ G D Sbjct: 121 VGLLRAGLPD-CTLR-VIEDHALIAVQGPAAAALVAGLVPAAEDLRFMQSAQAAWDGQDL 178 Query: 186 FVSRSGYTGEDGFEISVPATNAEALARALLAEAEVAAIGLGARDSLRLEAGLCLYGHDMN 245 +SR GYTGEDGFEIS+PAT AEA ARAL+A + A GLGARD+LR+EAGL LYG D++ Sbjct: 179 RLSRLGYTGEDGFEISLPATAAEAFARALIAGGAMPA-GLGARDTLRMEAGLPLYGQDID 237 Query: 246 TDTTPIEASLLWAISKPRRADGARAGGFPGAETVFAQQQAGVSRKRVGLLPQERTPVREG 305 T+P EA L ++I K RRA+ GGFPGA + + G +R+ VGL P+ R PVR G Sbjct: 238 QGTSPPEAGLGFSIPKRRRAE----GGFPGAARILGELADGPARRLVGLRPEGRAPVRAG 293 Query: 306 AEIVNEAGDIIGSVCSGGFGPTLGGPLAMGYVDSAYIALDTPVWAIVRGKKVPLLVSKMP 365 EI G +G+V SGGF PTL P++MGYV +++ A T + I+RGK P V+ +P Sbjct: 294 VEITAPDGTPLGTVTSGGFAPTLQAPISMGYVTASHAAPGTEIHVILRGKPQPATVTPLP 353 Query: 366 FVPQRYYR 373 FVP RY R Sbjct: 354 FVPHRYKR 361 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 361 Length adjustment: 30 Effective length of query: 344 Effective length of database: 331 Effective search space: 113864 Effective search space used: 113864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate 3609296 Dshi_2682 (glycine cleavage system T protein (RefSeq))
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.27835.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-95 304.7 0.0 4.6e-95 304.5 0.0 1.0 1 lcl|FitnessBrowser__Dino:3609296 Dshi_2682 glycine cleavage syste Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3609296 Dshi_2682 glycine cleavage system T protein (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 304.5 0.0 4.6e-95 4.6e-95 1 361 [. 2 356 .. 2 357 .. 0.94 Alignments for each domain: == domain 1 score: 304.5 bits; conditional E-value: 4.6e-95 TIGR00528 1 lkrtpLydlhtelggklvdfaGwelPvqy.kslieeheavrtkaGlfDvshmgkvelsGskslkfLqrllanDvdaL 76 lk+tpL+ lh elg+k+v+fa we+Pvqy ++++ eh a r+ a lfDvshm ++e++G++ ++L+rl++ + L lcl|FitnessBrowser__Dino:3609296 2 LKKTPLHPLHLELGAKMVPFAWWEMPVQYpTGIMAEHAACREGAALFDVSHMCQMEITGDDPAAALERLVPGGITSL 78 69***************************55789******************************************* PP TIGR00528 77 tkGkaqysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehleeevtldtlskeisllalqGPkakt 153 ++G+a+y+ l GG+ DDliv+++ +++v na+ a++D l+ l++ tl + ++ +l+a+qGP a++ lcl|FitnessBrowser__Dino:3609296 79 APGQARYTQLTTGAGGIYDDLIVTRDPGG--LYVVANASMADQDVGLLRAGLPDC-TL-RVIEDHALIAVQGPAAAA 151 ************************98887..9*****************999864.44.567788************ PP TIGR00528 154 iledlldkaveglkefffvqeaelalkkaliartGytGedGfeiavanekavelwkklveaygvkPiGLgarDtLrl 230 ++ l+ + +e+l+ + +a +++ ++r GytGedGfei+++ a ++++l++ g P GLgarDtLr+ lcl|FitnessBrowser__Dino:3609296 152 LVAGLVPA-AEDLRFMQSA-QAAWDGQDLRLSRLGYTGEDGFEISLPATAAEAFARALIAG-GAMPAGLGARDTLRM 225 *9999864.5677655555.566778999*******************************9.*************** PP TIGR00528 231 eagmaLyGqeldeeitPleaglgwvvkker.kksdfiGravleeqkengtekklvGlemlekgiarnelkvlltnge 306 eag++LyGq++d+ ++P eaglg+ + k r ++ f G a + ++g ++lvGl+ + r ++++ ++g lcl|FitnessBrowser__Dino:3609296 226 EAGLPLYGQDIDQGTSPPEAGLGFSIPKRRrAEGGFPGAARILGELADGPARRLVGLRPEGRAPVRAGVEITAPDG- 301 **************************88765999******************************************. PP TIGR00528 307 kevGivtsGtlsPtLgknialayvdkelekiGtklevevrnklvkikvvkklfvr 361 + G vtsG ++PtL+ i+++yv + Gt+++v +r+k ++ v+ +fv+ lcl|FitnessBrowser__Dino:3609296 302 TPLGTVTSGGFAPTLQAPISMGYVTASHAAPGTEIHVILRGKPQPATVTPLPFVP 356 *************************************************999986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (361 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 11.93 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory