Align methylmalonyl-CoA mutase (subunit 2/2) (EC 5.4.99.2) (characterized)
to candidate 3609471 Dshi_2855 methylmalonyl-CoA mutase, large subunit (RefSeq)
Query= BRENDA::O74009 (563 letters) >FitnessBrowser__Dino:3609471 Length = 657 Score = 357 bits (917), Expect = e-103 Identities = 210/489 (42%), Positives = 294/489 (60%), Gaps = 15/489 (3%) Query: 83 RGRIWTMRQYAGYATAEESNKRYKYLLSQGQTGLSVAFDLPTQLGYDSDHPLAEGEVGKV 142 + R W R YAG++TAE SN Y+ L++GQTGLSVAFDLPTQ GYDSDH L+ GEVGKV Sbjct: 8 KDRPWLFRTYAGHSTAEASNALYRGNLAKGQTGLSVAFDLPTQTGYDSDHVLSRGEVGKV 67 Query: 143 GVAIDSLWDMRILFDGIPLDKVSTSMTINSTAANLLAMYILVAEEQGVSQEKLRGTVQND 202 GV + L DMR LF IPLD+++TSMTIN+TA LL++YI VAEEQG KL+GTVQND Sbjct: 68 GVPVAHLGDMRALFKDIPLDQMNTSMTINATAPWLLSLYIAVAEEQGADVTKLQGTVQND 127 Query: 203 ILKEYIARGTYIFPPQPSMRLTTDIIMYCAENVPKWNPISISGYHIREAGANAVQEVAFT 262 I+KEY++RGTYI PP+PS+R+ TD+ Y E++PKWNP+++ YH++EAGA QE+AF Sbjct: 128 IIKEYLSRGTYICPPKPSLRMITDVAAYTREHLPKWNPMNVCSYHLQEAGATPEQELAFA 187 Query: 263 LADG---IEYVKAVIERGMDVDKFAPRLSFFFAAHNNFLEEIAKFRAARRLWAYIMKEWF 319 LA ++ +K + R+SFF A F+ E+ K RA LW I ++ + Sbjct: 188 LATATAVLDDLKGKVP-AEHFPAMVGRISFFVNAGIRFVTEMCKMRAFVTLWDEICRDRY 246 Query: 320 NAKNPRSMMLRFHTQTAGSTLTAQQPENNIVRVAIQALAAVL---GGTQSLHTNSYDEAL 376 ++P+ R+ Q LT QQPENN+ R+ I+ LA L +++ +++EAL Sbjct: 247 GVEDPKFRRFRYGVQVNSLGLTEQQPENNVYRILIEMLAVTLSKNARARAVQLPAWNEAL 306 Query: 377 SLPTEKSVRIALRTQQIIAYESGVVDTVDPLGGAYYIEWLTDHIYEEALKYIEKIQKMGG 436 LP + +LR QQI+A E+ +++ D G ++ + E A + I MGG Sbjct: 307 GLPRPWDQQWSLRMQQIMALETDLLEFDDLFDGNPAVDRKVAELMEGARAELATIDGMGG 366 Query: 437 MMRAIERGYVQKEIAEAAYKYQKEIEEGKRIIVGVNAFVTDEP-----IEVEILKVDPSI 491 + AIE Y++ + EA IE G+ ++VGVN + EP + I+ VDP++ Sbjct: 367 AVAAIE--YMKSRLVEANSDRLGRIEGGETVVVGVNKYQQGEPSPLMDADGGIMVVDPAV 424 Query: 492 REKQIERLKKLRSERDNKKVQEALDKLRNAAEKEDENLMPYIIEAHRHLATLQEVTDVLR 551 QI RL+ R+ RD Q+AL LR AA N+MP I A + T E +R Sbjct: 425 EADQIARLQAWRAARDEDAAQKALADLREAA-LSGANVMPASIAAAKAGVTTGEWGLEIR 483 Query: 552 EIWGEYRAP 560 + +GEYRAP Sbjct: 484 KSFGEYRAP 492 Lambda K H 0.318 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 820 Number of extensions: 40 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 563 Length of database: 657 Length adjustment: 37 Effective length of query: 526 Effective length of database: 620 Effective search space: 326120 Effective search space used: 326120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory