Align phosphotransacetylase (EC 2.3.1.8) (characterized)
to candidate 3610086 Dshi_3467 Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))., Phosphate acetyltransferase (RefSeq)
Query= metacyc::PTACLOS-MONOMER (333 letters) >FitnessBrowser__Dino:3610086 Length = 752 Score = 137 bits (345), Expect = 9e-37 Identities = 99/325 (30%), Positives = 164/325 (50%), Gaps = 12/325 (3%) Query: 3 LIESIWECAKQDKKRIILAEGEEKRNLIAADKIIKEGLAELVLVGDENKIKEK--ASELN 60 +++ ++ AK + R+I AEG++ R L AA + GL + ++VG ++ +K + A+ + Sbjct: 431 MLQGMFARAKGTQARMIFAEGDDIRVLRAAVTYQRSGLGKALVVGRQDDVKTRLEAAGIG 490 Query: 61 LDISKAEIMDPETSLKTETYARDFYELRKHKGMTIEKSEKMV-RDPLYFATMALKDGYVD 119 + EI++ + ETY Y + KG ++ RD F+ + L G+ D Sbjct: 491 DAFRELEIVNAGNTRHLETYKEFLYGRLQRKGYDTSDIHRLAARDRHAFSALMLAHGHGD 550 Query: 120 GMVSGAVHTTGDLLRPGLQIIKTAPGVKIVSGFFVMIIPDCDYGEEGLLLFADCAVNPNP 179 G+V+GA + +L + + A G +++ + ++L AD V+ P Sbjct: 551 GLVTGATRKSAHVLGL-INTVFDAGAEDGAVGVTALLV------KGRIVLIADTLVHEWP 603 Query: 180 TSDELADIAITTAETARKLCNVEPKVAMLSFSTMGSAKGEMVDKVKNAVEITKKFRPDLA 239 ++LADIA A TAR L +EP+VA +SFST G E K+ A + D Sbjct: 604 DEEDLADIATRAAGTARSL-GLEPRVAFVSFSTFGYPVSERATKMHRAPRVLDARGVDFE 662 Query: 240 IDGELQLDAAIDSEVAALKAPSSNVAGNANVLVFPDLQTGNIGYKLVQRFAKAKAIGPIC 299 DGE+ +D A+D E+ A + P ++G ANVLV P + +I KL+Q+ A IGPI Sbjct: 663 YDGEMTVDVALDPEIMA-QYPFCRLSGPANVLVVPARHSASISVKLMQQLGDATVIGPIL 721 Query: 300 QGFAKPINDLSRGCSSEDIVNVVAI 324 G KPI S ++ DI+N+ + Sbjct: 722 SGVGKPIQLCSATSTANDILNMAVL 746 Lambda K H 0.316 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 494 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 752 Length adjustment: 34 Effective length of query: 299 Effective length of database: 718 Effective search space: 214682 Effective search space used: 214682 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory