Align threonine ammonia-lyase (EC 4.3.1.19) (characterized)
to candidate 3610092 Dshi_3473 threonine dehydratase (RefSeq)
Query= BRENDA::Q04513 (436 letters) >FitnessBrowser__Dino:3610092 Length = 413 Score = 306 bits (785), Expect = 6e-88 Identities = 176/414 (42%), Positives = 240/414 (57%), Gaps = 7/414 (1%) Query: 23 AADIQTAQARISSVIAPTPLQYCPRLSEETGAEIYLKREDLQDVRSYKIRGALNSGAQLT 82 A + A + + + TPLQ LSE GAEI+LKREDL VRSYKIRGA N+ ++ Sbjct: 5 ADNAHRAASAMRPLFPATPLQMNIHLSERYGAEIWLKREDLSPVRSYKIRGAFNAISKRV 64 Query: 83 QEQRDAGIVAASAGNHAQGVAYVCKSLGVQGRIYVPVQTPKQKRDRIMVHGGEFVSLVVT 142 E + ASAGNHAQGVAY C+ GV G I++PV TP+QK D+ + GG + + + Sbjct: 65 AEGQTQ-FACASAGNHAQGVAYACQHFGVHGVIFMPVTTPRQKIDKTRIFGGTAIDIELV 123 Query: 143 GNNFDEASAAAHEDAERTGATLIEPFDARNTVIGQGTVAAEILSQLTSMGKSADHVMVPV 202 G+ FD+ AAA AT + PFD + + GQ TVA E+L QL D V++PV Sbjct: 124 GDYFDDTLAAAQRYCTEASATFLSPFDDADVIEGQSTVAVELLEQLEG---PPDMVILPV 180 Query: 203 GGGGLLAGVVSYMADMAPRTAIVGIEPAGAASMQAALHNGGPITLETVDPFVDGAAVKRV 262 GGGGL +G+ Y + + +EP GA S+ AL G P TL VD FVDGAAV R+ Sbjct: 181 GGGGLSSGMKRYFEVCGVQVDLRLVEPCGARSLAKALETGAPQTLSKVDNFVDGAAVARI 240 Query: 263 GDLNYTIVEKNQGRVHMMSATEGAVCTEMLDLYQNEGIIAEPAGALSIAGLKEM-SFAPG 321 G + I+ ++ H++ A E +C ML++ EGI+ EPAGAL++ L + G Sbjct: 241 GARPFEIL-RDVPPDHVLGAPEDRICHTMLEMLNVEGIVLEPAGALAVDVLDTLRDSITG 299 Query: 322 SVVVCIISGGNNDVLRYAEIAERSLVHRGLKHYFLVNFPQKPGQLRHFLEDILGPDDDIT 381 VVC+ SGGN D R E+ ERSL + GLK YF++ PQ+PG L+ FL LGPDDDI Sbjct: 300 KRVVCVTSGGNFDFERLPEVKERSLRYAGLKKYFILRLPQRPGALKEFL-GFLGPDDDIA 358 Query: 382 LFEYLKRNNRETGTALVGIHLSEASGLDSLLERMEESAIDSRRLEPGTPEYEYL 435 FEYLK++ R G+ L+GI +A + L R++ + R + E+L Sbjct: 359 RFEYLKKSARNFGSVLIGIETKDAGAFEQLFARLDAAGFPFRDITEDALLAEFL 412 Lambda K H 0.316 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 24 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 413 Length adjustment: 32 Effective length of query: 404 Effective length of database: 381 Effective search space: 153924 Effective search space used: 153924 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
Align candidate 3610092 Dshi_3473 (threonine dehydratase (RefSeq))
to HMM TIGR02079 (ilvA: threonine dehydratase (EC 4.3.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02079.hmm # target sequence database: /tmp/gapView.17604.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02079 [M=410] Accession: TIGR02079 Description: THD1: threonine dehydratase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-166 538.0 0.0 7.6e-166 537.9 0.0 1.0 1 lcl|FitnessBrowser__Dino:3610092 Dshi_3473 threonine dehydratase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3610092 Dshi_3473 threonine dehydratase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 537.9 0.0 7.6e-166 7.6e-166 4 410 .] 9 413 .] 6 413 .] 0.97 Alignments for each domain: == domain 1 score: 537.9 bits; conditional E-value: 7.6e-166 TIGR02079 4 ekakkrlkevvketPlqknerlsekykaeiylkredlqevrsyklrGaynkl.kqlsdeelekgvvcasaGnhaqGv 79 ++a+ +++++ tPlq+n +lse+y+aei+lkredl+ vrsyk+rGa+n++ k++++ + + casaGnhaqGv lcl|FitnessBrowser__Dino:3610092 9 HRAASAMRPLFPATPLQMNIHLSERYGAEIWLKREDLSPVRSYKIRGAFNAIsKRVAEG--QTQFACASAGNHAQGV 83 689999**********************************************4455544..45699*********** PP TIGR02079 80 ayacrklgvkgtvfmPvttPkqkvdkvklfGgefievilvGdtfdeaaaaakkavekegktlipPfddkdiieGqgt 156 ayac+++gv+g++fmPvttP+qk+dk+++fGg i++ lvGd fd++ aaa++ + + +t++ Pfdd d+ieGq+t lcl|FitnessBrowser__Dino:3610092 84 AYACQHFGVHGVIFMPVTTPRQKIDKTRIFGGTAIDIELVGDYFDDTLAAAQRYCTEASATFLSPFDDADVIEGQST 160 ***************************************************************************** PP TIGR02079 157 vaveileqleeekidlvlvpvGGGGlisGvtsylkekskktkiigvePeGapslkaslkagevvtldkidkfvdGaa 233 vave+leqle + +d+v++pvGGGGl+sG+ y++ + ++ veP Ga sl ++l++g + tl k+d+fvdGaa lcl|FitnessBrowser__Dino:3610092 161 VAVELLEQLEGP-PDMVILPVGGGGLSSGMKRYFEVCGVQVDLRLVEPCGARSLAKALETGAPQTLSKVDNFVDGAA 236 **********98.**************************************************************** PP TIGR02079 234 vkrvGdlnfkalkkvvd.evtlveegavcstildlynkegivaePaGalsiaaleelseeikgktvvcvvsGgnndi 309 v+r+G f++l++v +v +e+++c t+l+++n egiv+ePaGal++ l++l++ i+gk vvcv sGgn+d+ lcl|FitnessBrowser__Dino:3610092 237 VARIGARPFEILRDVPPdHVLGAPEDRICHTMLEMLNVEGIVLEPAGALAVDVLDTLRDSITGKRVVCVTSGGNFDF 313 ***************865999******************************************************** PP TIGR02079 310 erleeikersllyeGlkhyflvkfpqraGalreflndvlGPndditkfeyvkksnretGevliGielsdkedfeGll 386 erl+e+kersl+y Glk+yf++++pqr+Gal+efl lGP+ddi++fey+kks+r++G+vliGie++d+ fe l+ lcl|FitnessBrowser__Dino:3610092 314 ERLPEVKERSLRYAGLKKYFILRLPQRPGALKEFLG-FLGPDDDIARFEYLKKSARNFGSVLIGIETKDAGAFEQLF 389 ***********************************9.**************************************** PP TIGR02079 387 erlkaadieyeainenetlyellv 410 +rl+aa+ +++i+e+ l e+l+ lcl|FitnessBrowser__Dino:3610092 390 ARLDAAGFPFRDITEDALLAEFLI 413 *****************9999886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (410 nodes) Target sequences: 1 (413 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.11 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory